Citrus Sinensis ID: 046691
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| 255545086 | 222 | conserved hypothetical protein [Ricinus | 0.995 | 0.995 | 0.695 | 2e-80 | |
| 225462713 | 221 | PREDICTED: uncharacterized protein LOC10 | 0.981 | 0.986 | 0.644 | 1e-71 | |
| 449456359 | 224 | PREDICTED: uncharacterized protein LOC10 | 0.977 | 0.968 | 0.620 | 2e-65 | |
| 224116834 | 223 | predicted protein [Populus trichocarpa] | 0.963 | 0.959 | 0.586 | 1e-63 | |
| 297792703 | 221 | hypothetical protein ARALYDRAFT_918411 [ | 0.959 | 0.963 | 0.604 | 1e-62 | |
| 224120572 | 222 | predicted protein [Populus trichocarpa] | 0.981 | 0.981 | 0.613 | 3e-61 | |
| 388509236 | 211 | unknown [Lotus japonicus] | 0.896 | 0.943 | 0.559 | 8e-60 | |
| 18423499 | 221 | Ubiquitin-associated/translation elongat | 0.959 | 0.963 | 0.608 | 2e-58 | |
| 14190455 | 221 | AT5g53330/K19E1_13 [Arabidopsis thaliana | 0.959 | 0.963 | 0.604 | 4e-58 | |
| 357463783 | 203 | hypothetical protein MTR_3g090640 [Medic | 0.828 | 0.906 | 0.584 | 1e-55 |
| >gi|255545086|ref|XP_002513604.1| conserved hypothetical protein [Ricinus communis] gi|223547512|gb|EEF49007.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 303 bits (777), Expect = 2e-80, Method: Compositional matrix adjust.
Identities = 155/223 (69%), Positives = 180/223 (80%), Gaps = 2/223 (0%)
Query: 1 MDYDFRNRANSSYSLYGPPPSASSGGSAPSHHPMYGSSLYPRIGQQGSGHSMGPPVSRTS 60
MDYDFRNR S P ++ S PS HPMYG SLYPRIGQQ GH+ PPV R S
Sbjct: 1 MDYDFRNRTTGSSYDSQTPMYRTTSSSTPSGHPMYGQSLYPRIGQQ-QGHTPVPPVGRHS 59
Query: 61 SYNASPSPSSSSSGLGIRVALKPEYRITPPPTLSPQVGDIPRSNFHFDFDFERRVLAEAE 120
SY+ S +P SSSGLGIRV++KPEYRITPPP L+PQ+GDIPRSNF F FD ERR+LAEAE
Sbjct: 60 SYHQSSAPPPSSSGLGIRVSVKPEYRITPPPQLAPQMGDIPRSNFQFHFDLERRILAEAE 119
Query: 121 KENQNWSRLGMENIPSK-NEPTSSVGSGSDPVVSRYIALGLNREAVHIAVANYGDNPTKV 179
K+ QNWS+LG+EN+PSK E TSS+GS +DPVVS+YIA GLNREAV +AVANYGDNPTKV
Sbjct: 120 KDIQNWSKLGLENLPSKTTESTSSLGSAADPVVSKYIASGLNREAVPLAVANYGDNPTKV 179
Query: 180 REFANGYTILREMGFSSNNVAEVLIMYENDTDKALAHLLGSSA 222
REF NG+++LREMGFS+NNVAE L+MY+NDTDKAL H L SS+
Sbjct: 180 REFVNGFSLLREMGFSANNVAEALLMYDNDTDKALTHFLNSSS 222
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225462713|ref|XP_002267522.1| PREDICTED: uncharacterized protein LOC100260370 [Vitis vinifera] gi|147771502|emb|CAN66995.1| hypothetical protein VITISV_019167 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449456359|ref|XP_004145917.1| PREDICTED: uncharacterized protein LOC101219735 [Cucumis sativus] gi|449497294|ref|XP_004160364.1| PREDICTED: uncharacterized protein LOC101225916 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224116834|ref|XP_002331825.1| predicted protein [Populus trichocarpa] gi|222875063|gb|EEF12194.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297792703|ref|XP_002864236.1| hypothetical protein ARALYDRAFT_918411 [Arabidopsis lyrata subsp. lyrata] gi|297310071|gb|EFH40495.1| hypothetical protein ARALYDRAFT_918411 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224120572|ref|XP_002318363.1| predicted protein [Populus trichocarpa] gi|222859036|gb|EEE96583.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388509236|gb|AFK42684.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|18423499|ref|NP_568790.1| Ubiquitin-associated/translation elongation factor EF1B protein [Arabidopsis thaliana] gi|21536760|gb|AAM61092.1| proline-rich cell wall protein-like [Arabidopsis thaliana] gi|332008957|gb|AED96340.1| Ubiquitin-associated/translation elongation factor EF1B protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|14190455|gb|AAK55708.1|AF380627_1 AT5g53330/K19E1_13 [Arabidopsis thaliana] gi|15809720|gb|AAL06788.1| AT5g53330/K19E1_13 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357463783|ref|XP_003602173.1| hypothetical protein MTR_3g090640 [Medicago truncatula] gi|355491221|gb|AES72424.1| hypothetical protein MTR_3g090640 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| TAIR|locus:2154237 | 221 | AT5G53330 "AT5G53330" [Arabido | 0.963 | 0.968 | 0.521 | 4e-51 |
| TAIR|locus:2154237 AT5G53330 "AT5G53330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 531 (192.0 bits), Expect = 4.0e-51, P = 4.0e-51
Identities = 119/228 (52%), Positives = 141/228 (61%)
Query: 1 MDYDFRNRANXXXXXXXXXXXXXXXXXXXXXXXMYGSSLYPRIGQQ-GSGHSM-GPPVXX 58
MDYD+RN++ MYG YP+IGQQ G G PP
Sbjct: 1 MDYDYRNKSGGPSYPRPMYGPPSTSPSPSSNHPMYG---YPKIGQQTGPGPQFFSPP--- 54
Query: 59 XXXXXXXXXXXXXXXGLGIRVALKPEYRITPPPTLSPQVGDIPRSNFHFDFDFERRVLAE 118
G+GIRV LKPEYRITPPP L P+VGDI RS+F FDF ER+VLAE
Sbjct: 55 -ERNSSFQHNTSPSSGIGIRVNLKPEYRITPPPQLLPRVGDIHRSSFQFDFGLERKVLAE 113
Query: 119 AEKENQNWSRLGMENIPSK-NEPTXXXXXXXXXXXX---RYIALGLNREAVHIAVANYGD 174
AEK+N +WS+ G EN P+K +EP+ +Y A GLNREAV+IAVANYGD
Sbjct: 114 AEKDNPDWSKFGSENPPAKFHEPSPSSVGQMQGVDHVVMKYTASGLNREAVNIAVANYGD 173
Query: 175 NPTKVREFANGYTILREMGFSSNNVAEVLIMYENDTDKALAHLL-GSS 221
NPTKV+EFANG+T +REMGF +N VA+ L M+ENDTDKALAHLL GSS
Sbjct: 174 NPTKVQEFANGFTAIREMGFPTNAVADALFMFENDTDKALAHLLHGSS 221
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.317 0.135 0.400 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 222 170 0.00086 108 3 11 22 0.43 32
31 0.47 34
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 573 (61 KB)
Total size of DFA: 150 KB (2091 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 15.17u 0.08s 15.25t Elapsed: 00:00:02
Total cpu time: 15.17u 0.08s 15.25t Elapsed: 00:00:02
Start: Mon May 20 21:03:10 2013 End: Mon May 20 21:03:12 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00006488001 | SubName- Full=Putative uncharacterized protein (Chromosome undetermined scaffold_171, whole genome shotgun sequence); (221 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 98.55 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 98.52 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 98.47 | |
| KOG0011 | 340 | consensus Nucleotide excision repair factor NEF2, | 97.6 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 97.58 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 97.49 | |
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 97.48 | |
| KOG0944 | 763 | consensus Ubiquitin-specific protease UBP14 [Postt | 97.34 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 97.34 | |
| KOG2561 | 568 | consensus Adaptor protein NUB1, contains UBA domai | 97.03 | |
| KOG2561 | 568 | consensus Adaptor protein NUB1, contains UBA domai | 97.01 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 96.77 | |
| smart00546 | 43 | CUE Domain that may be involved in binding ubiquit | 96.65 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 95.87 | |
| PF02845 | 42 | CUE: CUE domain; InterPro: IPR003892 This domain m | 95.64 | |
| PRK00117 | 157 | recX recombination regulator RecX; Reviewed | 94.22 | |
| PF09288 | 55 | UBA_3: Fungal ubiquitin-associated domain ; InterP | 91.06 | |
| PF08938 | 79 | HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This | 90.94 | |
| PF09288 | 55 | UBA_3: Fungal ubiquitin-associated domain ; InterP | 90.03 | |
| KOG0418 | 200 | consensus Ubiquitin-protein ligase [Posttranslatio | 86.62 | |
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 86.08 | |
| PRK14136 | 309 | recX recombination regulator RecX; Provisional | 84.69 | |
| KOG0011 | 340 | consensus Nucleotide excision repair factor NEF2, | 84.47 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 83.08 | |
| PF02631 | 121 | RecX: RecX family; InterPro: IPR003783 RecX is a p | 83.0 | |
| cd04777 | 107 | HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding dom | 82.94 | |
| PF07223 | 358 | DUF1421: Protein of unknown function (DUF1421); In | 82.2 | |
| KOG0010 | 493 | consensus Ubiquitin-like protein [Posttranslationa | 82.14 | |
| PF06972 | 60 | DUF1296: Protein of unknown function (DUF1296); In | 82.13 | |
| PF09278 | 65 | MerR-DNA-bind: MerR, DNA binding; InterPro: IPR015 | 81.73 | |
| cd04783 | 126 | HTH_MerR1 Helix-Turn-Helix DNA binding domain of t | 81.55 | |
| PRK14135 | 263 | recX recombination regulator RecX; Provisional | 81.52 | |
| cd04784 | 127 | HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain | 80.3 | |
| TIGR02051 | 124 | MerR Hg(II)-responsive transcriptional regulator. | 80.25 |
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
Probab=98.55 E-value=6.8e-08 Score=62.26 Aligned_cols=34 Identities=29% Similarity=0.431 Sum_probs=30.4
Q ss_pred HHHHHHHhcCCCCchHHHHHHhccCCHHHHHHHH
Q 046691 184 NGYTILREMGFSSNNVAEVLIMYENDTDKALAHL 217 (222)
Q Consensus 184 ~~~~~L~EMGFp~~~VaeAL~~~dND~DKAL~~L 217 (222)
..+.+|++|||+.+.+.+||..|+||.|+|++.|
T Consensus 4 ~~v~~L~~mGf~~~~~~~AL~~~~~nve~A~~~L 37 (37)
T PF00627_consen 4 EKVQQLMEMGFSREQAREALRACNGNVERAVDWL 37 (37)
T ss_dssp HHHHHHHHHTS-HHHHHHHHHHTTTSHHHHHHHH
T ss_pred HHHHHHHHcCCCHHHHHHHHHHcCCCHHHHHHhC
Confidence 4578999999999999999999999999999976
|
The human homologue of yeast Rad23A is one example of a nucleotide excision-repair protein that contains both an internal and a C-terminal UBA domain. The solution structure of human Rad23A UBA(2) showed that the domain forms a compact three-helix bundle []. Comparison of the structures of UBA(1) and UBA(2) reveals that both form very similar folds and have a conserved large hydrophobic surface patch which may be a common protein-interacting surface present in diverse UBA domains. Evidence that ubiquitin binds to UBA domains leads to the prediction that the hydrophobic surface patch of UBA domains interacts with the hydrophobic surface on the five-stranded beta-sheet of ubiquitin []. This domain is similar in sequence to the N-terminal domain of translation elongation factor EF1B (or EF-Ts) from bacteria, mitochondria and chloroplasts. More information about EF1B (EF-Ts) proteins can be found at Protein of the Month: Elongation Factors [].; GO: 0005515 protein binding; PDB: 2DAI_A 2OO9_C 2JUJ_A 1WHC_A 1YLA_A 2O25_B 3K9O_A 3K9P_A 3F92_A 3E46_A .... |
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >PRK00117 recX recombination regulator RecX; Reviewed | Back alignment and domain information |
|---|
| >PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle | Back alignment and domain information |
|---|
| >PF08938 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This domain is found in various eukaryotic HBS1-like proteins | Back alignment and domain information |
|---|
| >PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle | Back alignment and domain information |
|---|
| >KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14136 recX recombination regulator RecX; Provisional | Back alignment and domain information |
|---|
| >KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >PF02631 RecX: RecX family; InterPro: IPR003783 RecX is a putative bacterial regulatory protein [] | Back alignment and domain information |
|---|
| >cd04777 HTH_MerR-like_sg1 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily | Back alignment and domain information |
|---|
| >PF07223 DUF1421: Protein of unknown function (DUF1421); InterPro: IPR010820 This family represents a conserved region approximately 350 residues long within a number of plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >PF06972 DUF1296: Protein of unknown function (DUF1296); InterPro: IPR009719 This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF09278 MerR-DNA-bind: MerR, DNA binding; InterPro: IPR015358 This entry represents a family of DNA-binding domains that are predominantly found in the prokaryotic transcriptional regulator MerR | Back alignment and domain information |
|---|
| >cd04783 HTH_MerR1 Helix-Turn-Helix DNA binding domain of the MerR1 transcription regulator | Back alignment and domain information |
|---|
| >PRK14135 recX recombination regulator RecX; Provisional | Back alignment and domain information |
|---|
| >cd04784 HTH_CadR-PbrR Helix-Turn-Helix DNA binding domain of the CadR and PbrR transcription regulators | Back alignment and domain information |
|---|
| >TIGR02051 MerR Hg(II)-responsive transcriptional regulator | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 4e-13 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 5e-13 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 4e-04 |
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 | Back alignment and structure |
|---|
Score = 62.7 bits (152), Expect = 4e-13
Identities = 18/76 (23%), Positives = 32/76 (42%)
Query: 142 SSVGSGSDPVVSRYIALGLNREAVHIAVANYGDNPTKVREFANGYTILREMGFSSNNVAE 201
S + V + +G + E V A+ G N ++ ++ + L E GF V E
Sbjct: 2 SHMSPSERQCVETVVNMGYSYECVLRAMKAAGANIEQILDYLFAHGQLCEKGFDPLLVEE 61
Query: 202 VLIMYENDTDKALAHL 217
L M++ +K + L
Sbjct: 62 ALEMHQCSEEKMMEFL 77
|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 99.71 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 99.19 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 98.67 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 98.52 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 98.52 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 98.49 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 98.49 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 98.38 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 98.35 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 98.33 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 98.32 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 98.24 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 98.2 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 98.18 | |
| 2dah_A | 54 | Ubiquilin-3; UBA domain, structural genomics, NPPS | 98.16 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 98.14 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 98.12 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 98.1 | |
| 2ekk_A | 47 | UBA domain from E3 ubiquitin-protein ligase HUWE1; | 98.09 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 98.08 | |
| 2dag_A | 74 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 98.06 | |
| 1whc_A | 64 | RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain | 98.04 | |
| 2cp8_A | 54 | NEXT to BRCA1 gene 1 protein; UBA domain, structur | 97.98 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 97.98 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 97.98 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 97.96 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 97.94 | |
| 2dkl_A | 85 | Trinucleotide repeat containing 6C protein; TNRC6C | 97.9 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 97.84 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 97.8 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 97.8 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 97.78 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 97.75 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 97.71 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 97.7 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 97.69 | |
| 1vek_A | 84 | UBP14, ubiquitin-specific protease 14, putative; U | 97.66 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 97.62 | |
| 1wgn_A | 63 | UBAP1, ubiquitin associated protein; ubiquitin ass | 97.57 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 97.56 | |
| 2ekk_A | 47 | UBA domain from E3 ubiquitin-protein ligase HUWE1; | 97.55 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 97.5 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 97.44 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 97.44 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 97.43 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 97.41 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 97.38 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 97.38 | |
| 1whc_A | 64 | RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain | 97.3 | |
| 2dag_A | 74 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 97.29 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 97.28 | |
| 2ooa_A | 52 | E3 ubiquitin-protein ligase CBL-B; alpha-helical d | 97.28 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 97.23 | |
| 2d9s_A | 53 | CBL E3 ubiquitin protein ligase; UBA domain, dimer | 97.19 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 97.19 | |
| 1vek_A | 84 | UBP14, ubiquitin-specific protease 14, putative; U | 97.18 | |
| 2oo9_A | 46 | E3 ubiquitin-protein ligase CBL; alpha-helical dom | 97.06 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 97.06 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 97.03 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 97.01 | |
| 2dkl_A | 85 | Trinucleotide repeat containing 6C protein; TNRC6C | 97.01 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 96.98 | |
| 2qsf_X | 171 | RAD23, UV excision repair protein RAD23; alpha-bet | 96.94 | |
| 2dhy_A | 67 | CUE domain-containing protein 1; structural genomi | 96.8 | |
| 1wgl_A | 59 | TOLL-interacting protein; CUE domain, structural g | 96.7 | |
| 2dah_A | 54 | Ubiquilin-3; UBA domain, structural genomics, NPPS | 96.69 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 96.53 | |
| 2ooa_A | 52 | E3 ubiquitin-protein ligase CBL-B; alpha-helical d | 96.32 | |
| 2d9s_A | 53 | CBL E3 ubiquitin protein ligase; UBA domain, dimer | 96.29 | |
| 2cos_A | 54 | Serine/threonine protein kinase LATS2; UBA domain, | 96.09 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 95.93 | |
| 1wgn_A | 63 | UBAP1, ubiquitin associated protein; ubiquitin ass | 95.86 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 95.8 | |
| 2cos_A | 54 | Serine/threonine protein kinase LATS2; UBA domain, | 95.62 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 95.4 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 95.23 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 94.67 | |
| 2cp8_A | 54 | NEXT to BRCA1 gene 1 protein; UBA domain, structur | 94.49 | |
| 1otr_A | 49 | Protein CUE2; protein-protein complex, cell cycle; | 94.4 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 94.39 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 94.27 | |
| 4dbg_B | 162 | Ring finger protein 31; ubiquitin fold, ubiquitina | 94.25 | |
| 2cp9_A | 64 | EF-TS, EF-TSMT, elongation factor TS, mitochondria | 94.21 | |
| 1q02_A | 52 | Sequestosome 1; helical bundle, protein binding; N | 93.85 | |
| 3dfg_A | 162 | Xcrecx, regulatory protein RECX; RECX RECA, homolo | 93.46 | |
| 2oo9_A | 46 | E3 ubiquitin-protein ligase CBL; alpha-helical dom | 93.13 | |
| 2qsf_X | 171 | RAD23, UV excision repair protein RAD23; alpha-bet | 90.82 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 90.79 | |
| 4fp9_B | 335 | Mterf domain-containing protein 2; modification en | 90.25 | |
| 1p3q_Q | 54 | VPS9P, vacuolar protein sorting-associated protein | 88.2 | |
| 3m66_A | 270 | Mterf3, mterf domain-containing protein 1, mitocho | 86.47 | |
| 3mva_O | 343 | Transcription termination factor, mitochondrial; a | 86.2 | |
| 4dbg_B | 162 | Ring finger protein 31; ubiquitin fold, ubiquitina | 86.15 | |
| 3m66_A | 270 | Mterf3, mterf domain-containing protein 1, mitocho | 85.47 | |
| 1q08_A | 99 | Zn(II)-responsive regulator of ZNTA; MERR family t | 84.75 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 84.66 | |
| 3mva_O | 343 | Transcription termination factor, mitochondrial; a | 84.65 | |
| 4fp9_B | 335 | Mterf domain-containing protein 2; modification en | 84.49 | |
| 3c1d_A | 159 | Protein ORAA, regulatory protein RECX; tandem repe | 83.71 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 83.38 | |
| 3d5l_A | 221 | Regulatory protein RECX; PSI-II, NYSGXRC, DNA repa | 83.15 | |
| 1b0n_B | 57 | Protein (SINI protein); transcription regulator, a | 82.1 |
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
Probab=99.71 E-value=9.9e-18 Score=132.40 Aligned_cols=75 Identities=27% Similarity=0.466 Sum_probs=68.8
Q ss_pred CCCcHHHHHHHHcCCCHHHHHHHHHHcCCChhHHHHHHHH----------------------------------HHHHHh
Q 046691 146 SGSDPVVSRYIALGLNREAVHIAVANYGDNPTKVREFANG----------------------------------YTILRE 191 (222)
Q Consensus 146 ~~~DP~V~ky~amG~~reaV~~Av~~yGdd~~KV~EFl~~----------------------------------~~~L~E 191 (222)
..+-.+|.+|++|||++++|.+||...|.|.+|++|||.. +++|.|
T Consensus 6 ~~e~~~v~~l~~MGFp~~~~~kAl~~~g~~~e~amewL~~h~~L~d~~~d~~~~e~~l~~~~~~~~~~~~~~~~v~~L~e 85 (118)
T 4ae4_A 6 PSERQCVETVVNMGYSYECVLRAMKAAGANIEQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKE 85 (118)
T ss_dssp HHHHHHHHHHHHTTCCHHHHHHHHHHHCSCHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHCSSCHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHcCCCHHHHHHHHHHHCcCHHHHHHHHHHhchhcccCCChhhhHHHHHhccCCccccccCHHHHHHHHH
Confidence 3455689999999999999999999999999999988754 789999
Q ss_pred cCCCCchHHHHHHhccCCHHHHHHHHhcc
Q 046691 192 MGFSSNNVAEVLIMYENDTDKALAHLLGS 220 (222)
Q Consensus 192 MGFp~~~VaeAL~~~dND~DKAL~~LLs~ 220 (222)
|||+.+.|++||..|+||.|||+|.|++.
T Consensus 86 MGF~~~~a~~AL~~~~nd~erAlewL~~~ 114 (118)
T 4ae4_A 86 MGFELKDIKEVLLLHNNDQDNALEDLMAR 114 (118)
T ss_dssp TTCCHHHHHHHHHHTTTCHHHHHHHHHHH
T ss_pred cCCCHHHHHHHHHHcCCCHHHHHHHHHHh
Confidence 99999999999999999999999999975
|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A | Back alignment and structure |
|---|
| >2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 | Back alignment and structure |
|---|
| >1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A | Back alignment and structure |
|---|
| >3dfg_A Xcrecx, regulatory protein RECX; RECX RECA, homologous recombination, tandem repeats, three-helix bundle, cytoplasm; 1.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >4fp9_B Mterf domain-containing protein 2; modification enzyme, transferase; HET: SAM; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A | Back alignment and structure |
|---|
| >3m66_A Mterf3, mterf domain-containing protein 1, mitochondrial; mitochondrion, DNA binding protein, transcription factor, transcription termination; 1.60A {Homo sapiens} PDB: 3opg_A 3my3_A | Back alignment and structure |
|---|
| >3mva_O Transcription termination factor, mitochondrial; all alpha-helix, protein-DNA, transcription factor, terminat mitochondria; 2.20A {Homo sapiens} PDB: 3n6s_A* 3mvb_O 3n7q_A* | Back alignment and structure |
|---|
| >4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >3m66_A Mterf3, mterf domain-containing protein 1, mitochondrial; mitochondrion, DNA binding protein, transcription factor, transcription termination; 1.60A {Homo sapiens} PDB: 3opg_A 3my3_A | Back alignment and structure |
|---|
| >1q08_A Zn(II)-responsive regulator of ZNTA; MERR family transcriptional regulator; 1.90A {Escherichia coli} SCOP: a.6.1.3 PDB: 1q09_A 1q0a_A | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >3mva_O Transcription termination factor, mitochondrial; all alpha-helix, protein-DNA, transcription factor, terminat mitochondria; 2.20A {Homo sapiens} PDB: 3n6s_A* 3mvb_O 3n7q_A* | Back alignment and structure |
|---|
| >4fp9_B Mterf domain-containing protein 2; modification enzyme, transferase; HET: SAM; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3c1d_A Protein ORAA, regulatory protein RECX; tandem repeats, helix-turn-helix, cytoplasm, DNA damage, DNA repair, SOS response, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >3d5l_A Regulatory protein RECX; PSI-II, NYSGXRC, DNA repair, 10123K, structural genomi protein structure initiative; 2.35A {Lactobacillus reuteri} | Back alignment and structure |
|---|
| >1b0n_B Protein (SINI protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 98.61 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 98.38 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 98.37 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 98.29 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 98.18 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 98.1 | |
| d1whca_ | 64 | UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta | 98.01 | |
| d2bwba1 | 44 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 98.0 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 97.97 | |
| d2daha1 | 41 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 97.89 | |
| d2dnaa1 | 50 | Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus | 97.87 | |
| d1veja1 | 61 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 97.86 | |
| d2crna1 | 51 | Suppressor of T-cell receptor signaling 2 (STS-2) | 97.8 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 97.76 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 97.73 | |
| d1veka_ | 84 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 97.49 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 97.47 | |
| d1whca_ | 64 | UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta | 97.46 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 97.44 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 97.42 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 97.3 | |
| d1veka_ | 84 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 96.69 | |
| d2crna1 | 51 | Suppressor of T-cell receptor signaling 2 (STS-2) | 96.65 | |
| d1oqya2 | 44 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 96.03 | |
| d3e46a1 | 42 | Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal | 95.91 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 95.76 | |
| d1xb2b1 | 56 | Elongation factor Ts (EF-Ts), N-terminal domain {C | 95.51 | |
| d1aipc1 | 52 | Elongation factor Ts (EF-Ts), N-terminal domain {T | 94.38 | |
| d1efub3 | 54 | Elongation factor Ts (EF-Ts), N-terminal domain {E | 94.34 | |
| d1mn3a_ | 54 | Vacuolar protein sorting-associated protein vps9 { | 93.81 | |
| d2dkla1 | 72 | Trinucleotide repeat containing 6c protein, TNRC6C | 93.52 | |
| d1z96a1 | 38 | UBA-domain protein mud1 {Schizosaccharomyces pombe | 93.5 | |
| d3e46a1 | 42 | Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal | 92.58 | |
| d1wgla_ | 59 | Toll-interacting protein {Human (Homo sapiens) [Ta | 92.57 | |
| d1wj7a1 | 91 | Ubiquitin-associated protein 2-like Ubap2l {Mouse | 92.21 | |
| d1veja1 | 61 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 91.02 | |
| d1ttea1 | 55 | Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc | 90.15 | |
| d2cp8a1 | 41 | Migration-inducing protein 19 NBR1 {Human (Homo sa | 90.13 | |
| d1vega_ | 83 | NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu | 87.81 | |
| d1ttea1 | 55 | Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc | 87.56 | |
| d1r8da_ | 109 | Multidrug transporter activator MtaN {Bacillus sub | 85.17 | |
| d1vega_ | 83 | NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu | 83.87 | |
| d2daha1 | 41 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 82.85 |
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: RuvA C-terminal domain-like superfamily: UBA-like family: UBA domain domain: DNA repair protein Hhr23a species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.61 E-value=8.8e-09 Score=67.06 Aligned_cols=39 Identities=26% Similarity=0.360 Sum_probs=35.1
Q ss_pred HHHHHHHHHHhcCCCCchHHHHHHhccCCHHHHHHHHhc
Q 046691 181 EFANGYTILREMGFSSNNVAEVLIMYENDTDKALAHLLG 219 (222)
Q Consensus 181 EFl~~~~~L~EMGFp~~~VaeAL~~~dND~DKAL~~LLs 219 (222)
||=....+|.+|||+.+.+..||..++||.|+|++.||+
T Consensus 3 ~~e~~i~~L~~MGF~~~~a~~AL~~~~~N~e~A~~~LlS 41 (41)
T d1oqya1 3 EYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLT 41 (41)
T ss_dssp THHHHHHHHHTTTCCSHHHHHHHHHSCSSTTHHHHTTTT
T ss_pred hHHHHHHHHHHcCCCHHHHHHHHHHhCCCHHHHHHHHhC
Confidence 344567899999999999999999999999999999985
|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r8da_ a.6.1.3 (A:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|