Citrus Sinensis ID: 046773

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450---

DGNGNGNGSGGVGGHYGARRGGDFEGPSSSRQRRRAVNEVWPEPFVEALAAQVAIEASRSVGRLAAAAALANVFQVCSTWRAVSRSDLLWHRLTRRIWGRTNLLHATWRDEYIYRHRTAQNFRTRRYTHFNLYFDPSDVDNPDGLTCRCLTLSDLYLACGFADGAVRLFDLTTRLHVRTFRPQHSDRLGQFSRAVSGIIITDSQLIFATLDGDIHVAVIDDVANETRTAHFGSVMDDGVLIDFTGCSRYWVGLYAGLAGRAFHIWDRQAEEVFVGGDLTDHNTVMGWRMLTEFTEFVGRVRVTSHESAVACTSSRVITFDLRNQGMVLGERGYGRGLYVTSVDVNAEAYIVVENRELENQNRRLAIVRRVDTFEEVCRFSLRADRNVNVMGCMNQGYALMCVEGVIRVWEVEGGEYMYSFRERIGEEVIAFVGDDRHVAASCGTNIHLWDFGA

cccccccccccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccEEEEEEEEccccccccccCEEEEEEEcccEEEEEEccccEEEEEcccccEEEEcccccccccccccccEEEEEEcccEEEEEEccccEEEEEEEccccCEEEEEEcccccccEEEEECcccCEEEEEEEEccccEEEEEEccccEEEEcccccccccEEEEEEEEEEccEEEEEEEccCEEEEEEcccEEEEEEcccccEEEEEEcccccEEEEEEEEccEEEEEEcccccccccccEEEEEEEEcccEEEEEEEccccEEEEEEEEcccEEEEEEccEEEEEEcccccEEEEcccccccEEEEEECccCEEEEEccccEEEECccc

*************************************NEVWPEPFVEALAAQVAIEASRSVGRLAAAAALANVFQVCSTWRAVSRSDLLWHRLTRRIWGRTNLLHATWRDEYIYRHRTAQNFRTRRYTHFNLYFDPSDVDNPDGLTCRCLTLSDLYLACGFADGAVRLFDLTTRLHVRTFRPQHSDRLGQFSRAVSGIIITDSQLIFATLDGDIHVAVIDDVANETRTAHFGSVMDDGVLIDFTGCSRYWVGLYAGLAGRAFHIWDRQAEEVFVGGDLTDHNTVMGWRMLTEFTEFVGRVRVTSHESAVACTSSRVITFDLRNQGMVLGERGYGRGLYVTSVDVNAEAYIVVENRELENQNRRLAIVRRVDTFEEVCRFSLRADRNVNVMGCMNQGYALMCVEGVIRVWEVEGGEYMYSFRERIGEEVIAFVGDDRHVAASCGTNIHLWDFGA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcriptional regulator STERILE APETALA	Transcriptional regulator involved in the specification of floral identity. Acts as A class cadastral protein by repressing the C class floral homeotic gene AGAMOUS in the external flower organs in association with APETALA2 and other repressors. Is required to maintain floral meristem identity in concert with AGAMOUS. Interacts also with APETALA2 to ensure the normal development of ovule.	probable	Q9FKH1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V7D, chain B
Confidence level:confident
Coverage over the Query: 40-452
View the alignment between query and template
View the model in PyMOL

Template: 2OIZ, chain A
Confidence level:confident
Coverage over the Query: 149-436
View the alignment between query and template
View the model in PyMOL