Citrus Sinensis ID: 046801

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MAIISDFQEDENKPDPKKNPSASASSSSPSSAKTSSFSATLDPSNPLGFLEKAFEFVAKESDFLTKDAAEKQIVAAMRAAKEKSSNTKKQPQPQSPHQEEVKAKKMKEEKKEEEKFEDLPTMKVQKAPPPEPQLDANGNPARAPNKGNGLDLENYSWTQILQEVTVSVPVPAGTKSRFVLCEIKKNHLKVGLKGQPPIIDGELHMAVKPDDCYWSIEDQKTVSILLTKQNQMEWWKCLIKGGPEIDTQKVEPENSKLSDLDPETRSTVEKMM
ccEEccccccccccccccccccccccccccccccccHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccCEEEEccccEEEEEEcccccccccEEEEEEccEEEEEEcccccEEcccccccccccccEEEEEcccEEEEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHc
MAIISD**********************************LDPSNPLGFLEKAFEFVAKESDFLTKDAAEKQIVAAMR********************************************************************GNGLDLENYSWTQILQEVTVSVPVPAGTKSRFVLCEIKKNHLKVGLKGQPPIIDGELHMAVKPDDCYWSIEDQKTVSILLTKQNQMEWWKCLIKGGPEIDTQ*****************STVE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIISDFQEDENKPDPKKNPSASASSSSPSSAKTSSFSATLDPSNPLGFLEKAFEFVAKESDFLTKDAAEKQIVAAMRAAKEKSSNTKKQPQPQSPHQEEVKAKKMKEEKKEEEKFEDLPTMKVQKAPPPEPQLDANGNPARAPNKGNGLDLENYSWTQILQEVTVSVPVPAGTKSRFVLCEIKKNHLKVGLKGQPPIIDGELHMAVKPDDCYWSIEDQKTVSILLTKQNQMEWWKCLIKGGPEIDTQKVEPENSKLSDLDPETRSTVEKMM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein BOBBER 1 Small heat shock protein required for the establishment of auxin gradients and for patterning of the apical domain of the embryo. Involved in the specification of the cotyledon primordia. Also required for normal inflorescence and floral meristem function, normal developmental patterning and thermotolerance. Acts as a molecular chaperone.probableQ9LV09

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WFI, chain A
Confidence level:very confident
Coverage over the Query: 146-272
View the alignment between query and template
View the model in PyMOL