Citrus Sinensis ID: 046828

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------
MKSNHNNNKQSNNNNIKHANGLNLIPNSLKFISSCIKTASSGVRSAGASVAASISGDSHELKDQVLWSSFDKLELSPSSFKHVLLLGYSNGFQVLDVEDATNVSELVSRRDDPVTFLQMQPLPAKSDGQEGFRNSHPLLLVVACDEAKNSGLVHVHVGRDGLVRDGYDEPQPGNVAMSPTAVRFYSLRSHNYVHVLRFRSTVYMVRCSPRIVAVGLAAQIYCFDALTLESKFSVLTYPVPHFGGQGTSGVNIGYGPMAVGPRWLAYASNNPLLPNTGRLSPQSLTPPSVSPSTSPSNGNLMARYAVESSKQLAAGLINLGDMGYKTLSRYYQDFIPDGSSSPVSSNSSWKAGRNASHSSDTDIAGMVVVKDIVSRSVISQFRAHTSPISALCFDRSGTLLVTASIHGNNINIFRIMPSSSKGRSGSASQTYDWTSSHVHLYKLHRGMTSAVIQDICFSHYSQWIAIVSSRGTCHIFVLTPFGGETVLQIQNSHVDRPTLSPVLSVPWWSSPSFMINQPSFSLPPPLPVTLSVVSRIKNNNSGWLNTVSSTASSTAGKTSIPSGALAAVFHSSLHQDLQPLDSKVNDLEHVLVYTPSGHVVQYKLLSSIGGESSELGKGLLCRCKMRS
cccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccEEEEEEEEcccccccccEEEEEEEcccEEEEEEcccccEEEccccccccEEEEEECcccccccccccccccccEEEEEEcccccccccCCcccccccCCcccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEEcccEEEEEEccEEEEEEcccccCEEEEECccccccccccccccccccccccccccEEEECccccccccccccccccccccccccccccccccccEEEEEEHHHHHcccEEEcccccEEEcccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEEcccccccccccccccccccccccEEEEEEEcccEEEEEEEEEcccccEEEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEcccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEEEEcccccEEEEEEEccccccccccccccEEEEECcc
***********************LIPNSLKFISSCIKTASSG*******************KDQVLWSSFDKLELSPSSFKHVLLLGYSNGFQVLDVEDATNVSELVSRRDDPVTFLQMQPLPAKSDGQEGFRNSHPLLLVVACDEAKNSGLVH****RDGLVRDG*******NVAMSPTAVRFYSLRSHNYVHVLRFRSTVYMVRCSPRIVAVGLAAQIYCFDALTLESKFSVLTYPVPHFGGQGTSGVNIGYGPMAVGPRWLAYASNNPLLP**********************NGNLMARYAVESSKQLAAGLINLGDMGYKTLSRYYQDFIPD*************************IAGMVVVKDIVSRSVISQFRAHTSPISALCFDRSGTLLVTASIHGNNINIFRIMP*****************SSHVHLYKLHRGMTSAVIQDICFSHYSQWIAIVSSRGTCHIFVLTPFGGE***************************************PPLPVTLSVV**I****S*WLN******************ALAAVFHSSLHQDLQPLDSKVNDLEHVLVYTPSGHVVQYKLLSSIGGE***LGKGLLCRCKM**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSNHNNNKQSNNNNIKHANGLNLIPNSLKFISSCIKTASSGVRSAGASVAASISGDSHELKDQVLWSSFDKLELSPSSFKHVLLLGYSNGFQVLDVEDATNVSELVSRRDDPVTFLQMQPLPAKSDGQEGFRNSHPLLLVVACDEAKNSGLVHVHVGRDGLVRDGYDEPQPGNVAMSPTAVRFYSLRSHNYVHVLRFRSTVYMVRCSPRIVAVGLAAQIYCFDALTLESKFSVLTYPVPHFGGQGTSGVNIGYGPMAVGPRWLAYASNNPLLPNTGRLSPQSLTPPSVSPSTSPSNGNLMARYAVESSKQLAAGLINLGDMGYKTLSRYYQDFIPDGSSSPVSSNSSWKAGRNASHSSDTDIAGMVVVKDIVSRSVISQFRAHTSPISALCFDRSGTLLVTASIHGNNINIFRIMPSSSKGRSGSASQTYDWTSSHVHLYKLHRGMTSAVIQDICFSHYSQWIAIVSSRGTCHIFVLTPFGGETVLQIQNSHVDRPTLSPVLSVPWWSSPSFMINQPSFSLPPPLPVTLSVVSRIKNNNSGWLNTVSSTASSTAGKTSIPSGALAAVFHSSLHQDLQPLDSKVNDLEHVLVYTPSGHVVQYKLLSSIGGESSELGKGLLCRCKMRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SFZ, chain A
Confidence level:confident
Coverage over the Query: 60-123,137-143,178-240,254-502
View the alignment between query and template
View the model in PyMOL
Template: 3VU4, chain A
Confidence level:confident
Coverage over the Query: 62-123,137-150,178-240,254-268,361-425,438-521
View the alignment between query and template
View the model in PyMOL
Template: 1Z68, chain A
Confidence level:confident
Coverage over the Query: 82-123,137-147,166-276,315-336,350-427,438-483
View the alignment between query and template
View the model in PyMOL
Template: 3IZ6, chain a
Confidence level:confident
Coverage over the Query: 60-123,137-240,254-272,354-426,439-480
View the alignment between query and template
View the model in PyMOL
Template: 1BPO, chain A
Confidence level:probable
Coverage over the Query: 364-417,434-493,515-606
View the alignment between query and template
View the model in PyMOL