Citrus Sinensis ID: 046885


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MEAQAQYWMWMKRQRDQILKYSFSDSSSSSWEEKAFAEDAAARSLGGCIWPPRSYSCSFCRREFKSAQALGGHMNVHRRDRARLKNSLNKSTHHKCPSDHSSPSNNVVVVASSPTLLNTRVTAALLTTAKENSSSSFVTINHEDDFVETNLSVGLKPDIWCDKTISCKRTKTSAAVSKSTQPFFMSSDKFSLQKENLDLELRLGDPSKMK
cccccEEEEEEcccHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccEEccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccEEEEccccccHcccccccccccccHHHHHHHHHcccccccccccccccEEEEHccccccHHHHHcccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccc
MEAQAQYWMWMKRQRDQILKysfsdsssssweEKAFAEDAAARSlggciwpprsyscsfcRREFKSAqalgghmnvhrrDRARLKnslnksthhkcpsdhsspsnnvvvvassptllNTRVTAALLTTAkenssssfvtinheddfvetnlsvglkpdiwcdktisckrtktsaavskstqpffmssdkfslqkenldlelrlgdpskmk
MEAQAQYWMWMKRQRDQILKYSFSDSSSSSWEEKAFAEDAAARSLGGCIWPPRSYSCSFCRREFKSaqalgghmnvhrrDRARLKNSLNKSTHhkcpsdhsspsnNVVVVASSPTLLNTRVTAALLTtakenssssfvtinheDDFVETNLSVGLKPDIWCDKTIsckrtktsaavskstqpffmssdkfslqkenldlelrlgdpskmk
MEAQAQYWMWMKRQRDQILKYsfsdsssssWEEKAFAEDAAARSLGGCIWPPRSYSCSFCRREFKSAQALGGHMNVHRRDRARLKNSLNKSTHHKCPSDHsspsnnvvvvasspTLLNTRVTAALLTTAKENSSSSFVTINHEDDFVETNLSVGLKPDIWCDKTISCKRTKTSAAVSKSTQPFFMSSDKFSLQKENLDLELRLGDPSKMK
*****QYWMWMKRQRDQILKY******************AAARSLGGCIWPPRSYSCSFCRREFKSAQAL*************************************VVVA***TLLNTRVTAAL****************HEDDFVETNLSVGLKPDIWCDKTISCKR*****************************************
****AQY**********************************************SYSCSFCRREFKSAQALG************************************************************************************************************************************G******
MEAQAQYWMWMKRQRDQILKY******************AAARSLGGCIWPPRSYSCSFCRREFKSAQALGGHMNVHRRDRARLKNS*****************NNVVVVASSPTLLNTRVTAALLTTAKENSSSSFVTINHEDDFVETNLSVGLKPDIWCDKTISCK*********KSTQPFFMSSDKFSLQKENLDLELRLGDPSKMK
***********KR******************************SLGGCIWPPRSYSCSFCRREFKSAQALGGHMNVHRRDRARLKNS*******************VVVVASSPTLLNTRVTAALLT********************************************************************NLDLELRLGD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAQAQYWMWMKRQRDQILKYSFSDSSSSSWEEKAFAEDAAARSLGGCIWPPRSYSCSFCRREFKSAQALGGHMNVHRRDRARLKNSLNKSTHHKCPSDHSSPSNNVVVVASSPTLLNTRVTAALLTTAKENSSSSFVTINHEDDFVETNLSVGLKPDIWCDKTISCKRTKTSAAVSKSTQPFFMSSDKFSLQKENLDLELRLGDPSKMK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query210 2.2.26 [Sep-21-2011]
Q9LHS9226 Probable transcriptional yes no 0.838 0.778 0.418 6e-26
Q38895204 Transcriptional regulator no no 0.704 0.725 0.370 1e-15
Q9SR34172 Transcriptional regulator no no 0.623 0.761 0.348 2e-12
Q39266209 Zinc finger protein 7 OS= no no 0.271 0.272 0.433 9e-08
Q42485228 Zinc finger protein 1 OS= no no 0.142 0.131 0.6 4e-06
Q39261150 Zinc finger protein 2 OS= no no 0.190 0.266 0.5 5e-06
Q39265197 Zinc finger protein 6 OS= no no 0.290 0.309 0.396 2e-05
Q39263260 Zinc finger protein 4 OS= no no 0.238 0.192 0.42 2e-05
Q9FFX4161 Zinc finger protein KNUCK no no 0.176 0.229 0.459 9e-05
Q39262235 Zinc finger protein 3 OS= no no 0.147 0.131 0.548 0.0001
>sp|Q9LHS9|RBE_ARATH Probable transcriptional regulator RABBIT EARS OS=Arabidopsis thaliana GN=RBE PE=2 SV=2 Back     alignment and function desciption
 Score =  117 bits (293), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 82/196 (41%), Positives = 101/196 (51%), Gaps = 20/196 (10%)

Query: 32  EEKAFAEDAAARSLGGCIWPPRSYSCSFCRREFKSAQALGGHMNVHRRDRARLK-NSLNK 90
           EE+AFA        GGC+WPPRSYSCSFC REFKSAQALGGHMNVHRRDRARLK  SL+ 
Sbjct: 32  EERAFASAEEYGGGGGCMWPPRSYSCSFCGREFKSAQALGGHMNVHRRDRARLKQQSLSP 91

Query: 91  STHHKCPSDHSSPSNNVVVVASSPTLLNTRVTAALLTTAKENS--------SSSFVTINH 142
           S+  +           V+ V S   +L    T     T +E S         SS     H
Sbjct: 92  SSTDQATPPECDRQQQVLDVGSK--VLVQEETRKPNGTKREISDVCNNNVLESSMKRYEH 149

Query: 143 EDDFVETNLSVGL--------KPDIWCDKTISCKRTKTSAAVSKSTQPFFMSSDKFSLQK 194
           ++  V+T+LSVGL        K  +    + S KR KT  +         +   + +   
Sbjct: 150 DNGEVKTDLSVGLLSTEFDPRKKQLINGSSSSWKRAKTDVSRFPMMLGLVIGISEINGHH 209

Query: 195 ENLDLELRLG-DPSKM 209
           E LDLELRLG DP K+
Sbjct: 210 EELDLELRLGADPPKV 225




Probable transcriptional regulator essential for petal development. Required for the early development of the organ primordia of the second whorl. Acts downstream of AP1 and PTL.
Arabidopsis thaliana (taxid: 3702)
>sp|Q38895|SUP_ARATH Transcriptional regulator SUPERMAN OS=Arabidopsis thaliana GN=SUP PE=1 SV=1 Back     alignment and function description
>sp|Q9SR34|TAC1_ARATH Transcriptional regulator TAC1 OS=Arabidopsis thaliana GN=TAC1 PE=2 SV=1 Back     alignment and function description
>sp|Q39266|ZFP7_ARATH Zinc finger protein 7 OS=Arabidopsis thaliana GN=ZFP7 PE=2 SV=1 Back     alignment and function description
>sp|Q42485|ZFP1_ARATH Zinc finger protein 1 OS=Arabidopsis thaliana GN=ZFP1 PE=2 SV=1 Back     alignment and function description
>sp|Q39261|ZFP2_ARATH Zinc finger protein 2 OS=Arabidopsis thaliana GN=ZFP2 PE=2 SV=1 Back     alignment and function description
>sp|Q39265|ZFP6_ARATH Zinc finger protein 6 OS=Arabidopsis thaliana GN=ZFP6 PE=2 SV=1 Back     alignment and function description
>sp|Q39263|ZFP4_ARATH Zinc finger protein 4 OS=Arabidopsis thaliana GN=ZFP4 PE=2 SV=2 Back     alignment and function description
>sp|Q9FFX4|KNU_ARATH Zinc finger protein KNUCKLES OS=Arabidopsis thaliana GN=KNU PE=1 SV=1 Back     alignment and function description
>sp|Q39262|ZFP3_ARATH Zinc finger protein 3 OS=Arabidopsis thaliana GN=ZFP3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
255566456272 Transcriptional regulator SUPERMAN, puta 0.947 0.731 0.405 1e-35
224112713290 predicted protein [Populus trichocarpa] 0.952 0.689 0.383 2e-32
356537940264 PREDICTED: probable transcriptional regu 0.961 0.765 0.392 5e-32
292606435 317 Superman-like protein FRASUP5 [Fragaria 0.428 0.283 0.67 2e-30
224140299300 predicted protein [Populus trichocarpa] 0.733 0.513 0.476 1e-29
224098459304 predicted protein [Populus trichocarpa] 0.423 0.292 0.695 1e-29
315661283 327 transcriptional regulator superman [Malu 0.619 0.397 0.524 3e-29
225449420282 PREDICTED: uncharacterized protein LOC10 0.938 0.698 0.373 7e-29
292606437154 Superman-like protein [Fragaria virginia 0.457 0.623 0.623 3e-28
147821464 866 hypothetical protein VITISV_037365 [Viti 0.657 0.159 0.503 8e-28
>gi|255566456|ref|XP_002524213.1| Transcriptional regulator SUPERMAN, putative [Ricinus communis] gi|223536490|gb|EEF38137.1| Transcriptional regulator SUPERMAN, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 112/276 (40%), Positives = 143/276 (51%), Gaps = 77/276 (27%)

Query: 4   QAQYWMWMKRQRDQILKYS----FSDSSSSSWEEKAFAEDAAARSLGGCIWPPRSYSCSF 59
           Q Q WM MKR+  Q LK      + +S + SWEE+AFAEDA+   LGGCIWPPRSYSCSF
Sbjct: 3   QPQRWMLMKRR--QFLKSDNFQVWKNSVNDSWEERAFAEDASGH-LGGCIWPPRSYSCSF 59

Query: 60  CRREFKSAQALGGHMNVHRRDRARLKNSLNKS-THHK----------------------- 95
           C+REF+SAQALGGHMNVHRRDRARLK SL+ S T H+                       
Sbjct: 60  CKREFRSAQALGGHMNVHRRDRARLKQSLSSSSTPHQNNSDTFQYQNHSQPTLEGFNSHF 119

Query: 96  ----CPSDHSSPSNNVVVVASSPTLLNTRVTAALLTTAKENSSSSFVT-INHE------- 143
               C  DH    N+   V +S    ++RV+A  L+T +  S  +FV+ I  E       
Sbjct: 120 PSEFCTLDHEHGPNSSSSVIASTLTSSSRVSA--LSTQENLSDHTFVSSIIQEKLNRTEV 177

Query: 144 --------------DDFVETNLSVGLK------PDIWCDKTISCKRTKTSAAVSKSTQPF 183
                         D+FVET+L VG        P       ISCKR KT+ +     +P 
Sbjct: 178 VKNPREEDSTGLCNDNFVETDLFVGFNSVLSRNPSTGPYGDISCKRPKTAVSALSLIKP- 236

Query: 184 FMSSDKFSLQKE----------NLDLELRLGDPSKM 209
             SSD++S+  E          ++DLELRLG+P K+
Sbjct: 237 -CSSDRYSIHSEATEANSSSMEDIDLELRLGEPPKV 271




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224112713|ref|XP_002316269.1| predicted protein [Populus trichocarpa] gi|222865309|gb|EEF02440.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356537940|ref|XP_003537464.1| PREDICTED: probable transcriptional regulator RABBIT EARS-like [Glycine max] Back     alignment and taxonomy information
>gi|292606435|gb|ADE34119.1| Superman-like protein FRASUP5 [Fragaria virginiana subsp. virginiana] Back     alignment and taxonomy information
>gi|224140299|ref|XP_002323520.1| predicted protein [Populus trichocarpa] gi|222868150|gb|EEF05281.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098459|ref|XP_002311181.1| predicted protein [Populus trichocarpa] gi|222851001|gb|EEE88548.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|315661283|gb|ADU55570.1| transcriptional regulator superman [Malus x domestica] Back     alignment and taxonomy information
>gi|225449420|ref|XP_002277873.1| PREDICTED: uncharacterized protein LOC100249572 [Vitis vinifera] gi|296086193|emb|CBI31634.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|292606437|gb|ADE34120.1| Superman-like protein [Fragaria virginiana subsp. virginiana] Back     alignment and taxonomy information
>gi|147821464|emb|CAN72262.1| hypothetical protein VITISV_037365 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query210
TAIR|locus:505006582226 RBE "AT5G06070" [Arabidopsis t 0.847 0.787 0.412 9.7e-25
TAIR|locus:2040726 304 ZFP10 "AT2G37740" [Arabidopsis 0.252 0.174 0.807 1.9e-24
TAIR|locus:2129495204 AT4G17810 "AT4G17810" [Arabido 0.323 0.333 0.533 1.7e-20
TAIR|locus:2086268204 SUP "AT3G23130" [Arabidopsis t 0.185 0.191 0.846 1e-18
TAIR|locus:2053796214 ZFP11 "AT2G42410" [Arabidopsis 0.733 0.719 0.347 7.7e-16
TAIR|locus:2083574172 TAC1 "AT3G09290" [Arabidopsis 0.171 0.209 0.722 7.2e-15
TAIR|locus:2084390142 AT3G53820 "AT3G53820" [Arabido 0.166 0.246 0.628 3.6e-12
TAIR|locus:2158367137 AT5G43540 "AT5G43540" [Arabido 0.209 0.321 0.530 9.3e-12
TAIR|locus:2174547150 ZFP2 "AT5G57520" [Arabidopsis 0.242 0.34 0.392 2.1e-10
TAIR|locus:2086193172 URO "AT3G23140" [Arabidopsis t 0.204 0.25 0.488 1.7e-08
TAIR|locus:505006582 RBE "AT5G06070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 282 (104.3 bits), Expect = 9.7e-25, P = 9.7e-25
 Identities = 80/194 (41%), Positives = 98/194 (50%)

Query:    32 EEKAFAEDAAARSLGGCIWPPRSYSCSFCRREFKSAQALGGHMNVHRRDRARLKN-SLN- 89
             EE+AFA        GGC+WPPRSYSCSFC REFKSAQALGGHMNVHRRDRARLK  SL+ 
Sbjct:    32 EERAFASAEEYGGGGGCMWPPRSYSCSFCGREFKSAQALGGHMNVHRRDRARLKQQSLSP 91

Query:    90 KSTHHKCPSDHXXXXXXXXXXXXXXTLLNTRV---TAALLTTAKENS--SSSFVTINHED 144
              ST    P +                   TR    T   ++    N+   SS     H++
Sbjct:    92 SSTDQATPPECDRQQQVLDVGSKVLVQEETRKPNGTKREISDVCNNNVLESSMKRYEHDN 151

Query:   145 DFVETNLSVGL--------KPDIWCDKTISCKRTKTSAAVSKSTQPFFMSSDKFSLQKEN 196
               V+T+LSVGL        K  +    + S KR KT  +         +   + +   E 
Sbjct:   152 GEVKTDLSVGLLSTEFDPRKKQLINGSSSSWKRAKTDVSRFPMMLGLVIGISEINGHHEE 211

Query:   197 LDLELRLG-DPSKM 209
             LDLELRLG DP K+
Sbjct:   212 LDLELRLGADPPKV 225




GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0009934 "regulation of meristem structural organization" evidence=NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0048441 "petal development" evidence=IMP
GO:0048446 "petal morphogenesis" evidence=RCA
GO:0009409 "response to cold" evidence=IEP
TAIR|locus:2040726 ZFP10 "AT2G37740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129495 AT4G17810 "AT4G17810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086268 SUP "AT3G23130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053796 ZFP11 "AT2G42410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083574 TAC1 "AT3G09290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084390 AT3G53820 "AT3G53820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158367 AT5G43540 "AT5G43540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174547 ZFP2 "AT5G57520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086193 URO "AT3G23140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0022022601
hypothetical protein (290 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 210
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 98.68
PHA0276855 hypothetical protein; Provisional 98.66
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 98.44
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 98.2
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 98.03
PHA0061644 hypothetical protein 98.01
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 97.95
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.88
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 97.74
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.73
KOG3576267 consensus Ovo and related transcription factors [T 97.73
PHA0073279 hypothetical protein 97.66
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.55
PHA00733128 hypothetical protein 97.52
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.46
smart0035526 ZnF_C2H2 zinc finger. 97.3
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.45
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 96.39
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.18
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.46
KOG3993500 consensus Transcription factor (contains Zn finger 95.01
KOG3576267 consensus Ovo and related transcription factors [T 94.82
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.58
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 94.29
KOG3608467 consensus Zn finger proteins [General function pre 93.69
PRK04860160 hypothetical protein; Provisional 93.55
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.44
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.29
PHA00733128 hypothetical protein 93.0
PLN03086567 PRLI-interacting factor K; Provisional 92.73
PLN03086567 PRLI-interacting factor K; Provisional 92.44
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 91.74
COG5189423 SFP1 Putative transcriptional repressor regulating 90.33
COG5189423 SFP1 Putative transcriptional repressor regulating 84.92
KOG3993500 consensus Transcription factor (contains Zn finger 84.06
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 82.69
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 81.99
KOG4167907 consensus Predicted DNA-binding protein, contains 80.86
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=98.68  E-value=4.4e-09  Score=94.96  Aligned_cols=47  Identities=21%  Similarity=0.472  Sum_probs=42.5

Q ss_pred             ccccCccccccCCcchHHHHhhhcCCcchhhhccCCCCCCCCCCCCCCCCCCCCc
Q 046885           54 SYSCSFCRREFKSAQALGGHMNVHRRDRARLKNSLNKSTHHKCPSDHSSPSNNVV  108 (210)
Q Consensus        54 PY~C~~CgK~FsssqALggHmriHtgERp~~~q~p~~~~h~iCg~~F~~~~~Lg~  108 (210)
                      |++|.+|||.|++..-|.||+|+||||||      |  .|..|++.|+-..||--
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiRTHTGEKP------F--~C~hC~kAFADRSNLRA  233 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIRTHTGEKP------F--SCPHCGKAFADRSNLRA  233 (279)
T ss_pred             CcccccccccccchHHhhcccccccCCCC------c--cCCcccchhcchHHHHH
Confidence            79999999999999999999999999994      5  79999999988888854



>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
2l1o_A39 Zinc To Cadmium Replacement In The A. Thaliana Supe 9e-11
>pdb|2L1O|A Chain A, Zinc To Cadmium Replacement In The A. Thaliana Superman Cys2his2 Zinc Finger Induces Structural Rearrangements Of Typical Dna Base Determinant Positions Length = 39 Back     alignment and structure

Iteration: 1

Score = 63.5 bits (153), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 25/28 (89%), Positives = 28/28 (100%) Query: 50 WPPRSYSCSFCRREFKSAQALGGHMNVH 77 WPPRSY+CSFC+REF+SAQALGGHMNVH Sbjct: 2 WPPRSYTCSFCKREFRSAQALGGHMNVH 29

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query210
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 9e-21
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
 Score = 80.2 bits (198), Expect = 9e-21
 Identities = 32/36 (88%), Positives = 36/36 (100%)

Query: 50 WPPRSYSCSFCRREFKSAQALGGHMNVHRRDRARLK 85
          WPPRSY+CSFC+REF+SAQALGGHMNVHRRDRARL+
Sbjct: 2  WPPRSYTCSFCKREFRSAQALGGHMNVHRRDRARLR 37


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.28
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.13
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.07
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.97
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.96
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.93
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.92
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.92
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 98.91
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.9
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.87
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.87
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.85
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.85
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.85
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.85
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.84
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.84
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.84
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.84
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.84
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.83
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.83
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.83
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.82
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.82
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.81
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.81
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.81
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.81
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.79
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.79
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.78
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.78
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.77
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.77
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.77
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.77
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.77
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.76
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.76
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.75
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.23
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.75
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.75
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.75
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 98.74
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.21
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.74
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.73
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.73
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 98.73
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.73
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.72
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.72
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.72
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.71
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.71
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.71
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 98.7
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.7
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.7
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.69
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.69
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.69
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.69
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.68
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.68
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.68
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.68
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.68
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.68
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.67
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.67
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.67
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.67
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.67
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.66
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.66
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.66
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 98.66
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.66
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.66
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.65
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.64
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.64
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.64
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.64
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.64
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.63
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.63
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.63
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.63
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.63
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.63
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.62
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.61
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.58
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 98.57
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.57
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.56
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.56
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.56
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.55
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.55
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.55
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.54
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 98.54
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.54
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.54
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.54
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.53
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.52
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.92
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.51
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.5
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 98.5
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.49
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 98.46
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.45
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 98.45
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 98.43
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.41
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.4
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.38
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.37
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.37
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.37
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 98.36
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.34
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 98.34
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.33
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.32
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.3
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.29
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.29
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.28
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.27
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.26
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 98.25
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 98.24
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.24
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 98.24
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 98.21
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.2
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 98.18
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.18
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 98.14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.13
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.13
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 98.12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.1
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.05
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.02
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 97.99
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 97.99
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 97.97
2lv2_A85 Insulinoma-associated protein 1; structural genomi 97.97
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 97.97
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 97.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 97.96
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 97.95
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 97.93
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 97.78
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 97.67
2epa_A72 Krueppel-like factor 10; transforming growth facto 97.49
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 97.44
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 97.44
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.4
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 97.03
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 96.12
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.01
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 95.56
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 95.48
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 95.37
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 95.29
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 95.28
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.24
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.13
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 95.03
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 95.01
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 95.0
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 94.97
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 94.94
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 94.94
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 94.93
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.93
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.92
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.88
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 94.85
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.83
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 94.83
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.76
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 94.71
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.71
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.66
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 94.64
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.63
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.63
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.63
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.63
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 94.61
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.59
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.57
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.54
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.53
1vd4_A62 Transcription initiation factor IIE, alpha subunit 94.53
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.52
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 94.51
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.49
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.4
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.35
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.33
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.32
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.29
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.29
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.26
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.22
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 94.22
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.21
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 94.2
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.19
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.18
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.18
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.17
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.17
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.14
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 94.03
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.03
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.0
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.97
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.96
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 93.93
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.92
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.88
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 93.87
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 93.86
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 93.84
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.79
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 93.78
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.78
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.77
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 93.76
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.72
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 93.69
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 93.68
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 93.64
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.64
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 93.59
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 93.58
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 93.57
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 93.56
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.44
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 93.42
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 93.39
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 93.23
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 93.13
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 93.07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 93.01
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 92.99
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 92.93
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 90.55
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.58
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 88.52
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 86.81
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 85.8
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 85.2
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 81.69
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
Probab=99.28  E-value=2.4e-13  Score=93.85  Aligned_cols=48  Identities=23%  Similarity=0.469  Sum_probs=43.6

Q ss_pred             CCccccCccccccCCcchHHHHhhhcCCcchhhhccCCCCCCCCCCCCCCCCCCCC
Q 046885           52 PRSYSCSFCRREFKSAQALGGHMNVHRRDRARLKNSLNKSTHHKCPSDHSSPSNNV  107 (210)
Q Consensus        52 eKPY~C~~CgK~FsssqALggHmriHtgERp~~~q~p~~~~h~iCg~~F~~~~~Lg  107 (210)
                      ||||+|.+|||.|.+..+|..|+++|+++|      |+  .|.+||+.|....+|-
T Consensus         2 EKpy~C~~C~k~F~~~~~L~~H~~~Ht~ek------p~--~C~~C~k~F~~~~~L~   49 (60)
T 4gzn_C            2 ERPFFCNFCGKTYRDASGLSRHRRAHLGYR------PR--SCPECGKCFRDQSEVN   49 (60)
T ss_dssp             CCCEECTTTCCEESSHHHHHHHHHHHHTCC------CE--ECTTTCCEESSHHHHH
T ss_pred             CCCccCCCCCCEeCCHHHHHHHHHHhCCCc------Ce--ECCCCCCCcCCHHHHH
Confidence            799999999999999999999999999998      45  8999999998766553



>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 210
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 9e-18
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 71.3 bits (175), Expect = 9e-18
 Identities = 32/36 (88%), Positives = 36/36 (100%)

Query: 50 WPPRSYSCSFCRREFKSAQALGGHMNVHRRDRARLK 85
          WPPRSY+CSFC+REF+SAQALGGHMNVHRRDRARL+
Sbjct: 1  WPPRSYTCSFCKREFRSAQALGGHMNVHRRDRARLR 36


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query210
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 99.3
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.2
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.19
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.14
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.09
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.06
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.04
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.95
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.91
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.91
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.89
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.88
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.87
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.83
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.69
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.66
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.61
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.58
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.55
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.51
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.48
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.26
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.25
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.01
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.82
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.82
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.6
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.48
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.47
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.44
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.29
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.28
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 97.11
d2cota238 Zinc finger and SCAN domain-containing protein 16, 96.74
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.67
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.51
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.33
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.28
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.82
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.74
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.52
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 95.5
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 95.2
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.18
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.93
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.72
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 93.64
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.56
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 93.51
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.97
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.25
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.25
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 90.65
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 90.04
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 90.0
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.08
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.83
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 88.6
d1y0jb136 U-shaped transcription factor, different fingers { 88.37
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 86.78
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 86.29
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 80.13
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.30  E-value=3.6e-13  Score=86.60  Aligned_cols=36  Identities=89%  Similarity=1.677  Sum_probs=33.8

Q ss_pred             CCCCccccCccccccCCcchHHHHhhhcCCcchhhh
Q 046885           50 WPPRSYSCSFCRREFKSAQALGGHMNVHRRDRARLK   85 (210)
Q Consensus        50 ~~eKPY~C~~CgK~FsssqALggHmriHtgERp~~~   85 (210)
                      ||.|.|+|.+|+|.|.+.|||||||+.|+.+|.+++
T Consensus         1 ~p~r~~~C~~C~k~F~s~qALGGH~~~Hr~~r~~~k   36 (37)
T d1njqa_           1 WPPRSYTCSFCKREFRSAQALGGHMNVHRRDRARLR   36 (37)
T ss_dssp             CCSSSEECTTTCCEESSHHHHHHHHHTTCCSCTTTT
T ss_pred             CCCCccCCCCCCCccCCcccccchHhhhcchHHHhc
Confidence            899999999999999999999999999999987654



>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure