Citrus Sinensis ID: 046901

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--

METNQVVTKQSAFRGVRMRKWGKWVSEIRQPGTKTRIWLGSYETPEMAAAAYDVAALHFRGRSGAHLNFPELADTLPRPASSKPEDVQLAAQEAALSFRKPIAENCSLGPVRIGLSPSQIQAINESPLDSPKMWMELAAGTFWSPEQMLLYDGIDEVCEWGNYDMQVESIWD

ccccccccccccccEEEEcccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccc

***********AFRGVRMRKWGKWVSEIRQPGTKTRIWLGSYETPEMAAAAYDVAALHFRGRSGAHLNFPELADTL*********DVQLAAQ***********************************LDSPKMWMELAAGTFWSPEQMLLYDGIDEVCEWGNYDMQVESIWD

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

METNQVVTKQSAFRGVRMRKWGKWVSEIRQPGTKTRIWLGSYETPEMAAAAYDVAALHFRGRSGAHLNFPELADTLPRPASSKPEDVQLAAQEAALSFRKPIAENCSLGPVRIGLSPSQIQAINESPLDSPKMWMELAAGTFWSPEQMLLYDGIDEVCEWGNYDMQVESIWD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ethylene-responsive transcription factor ERF021	Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.	probable	Q9C9I2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 12-72
View the alignment between query and template
View the model in PyMOL