Citrus Sinensis ID: 046902

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390---

MSKKIPLDIITGIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKGAHDLYALDFDTLTLGTGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCLVGFPSAFTFYGFGQDKINDDYKLVRVLHFKGNDGDDVEVEVYSLKTNSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIVAFDLVAEEFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFRFYNLVYVDMWMMKEHAVKESWTKLFSVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDFVDTEICMASLVPLSDKGGGCGGGINGMKRRNLEEKEKRHKKKR

ccccccHHHHHHHHHcccHHHHHHEEccccccHHHccccHHHHHHHHcccccccccEEEEEcccccEEEcccccccccccccccccccccccEEEEEEEccEEEEEEcccCEEEEcccccCEEEcccccccccccccEEEEEEEECcccccEEEEEEEEECcccccccEEEEEEcccccEEEEcccccccccccccccccccccccCEEEccEEEEEEEccccccEEEEEEccccCEEECccccccccccccEEEEEcEEccEEEEEEEccccEEEEEEEEEccccccEEEEEEEcccccccccccccEEEEEEcccEEEEEEEccEEEEEEccccEEEEEEEEccccccCEEEEEEccccccccccccccccccccccccHHHHHHHHHHcc

*SKKIPLDIITGIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLILKGAHDLYALDFDTLTLGTGVQPHHHPLNIGSGTEVLGSCNGLIALCNSVQELALFNPSTRKLKTLPLPPCLVGFPSAFTFYGFGQDKINDDYKLVRVLHFKGNDGDDVEVEVYSLKTNSWRRISNLPRFLRDFYDYLYHSLFRKGYGVLAGGALHWVSPKSSTRSVIVAFDLVAEEFYQLPLPDSVNVSYANVHVDVGSLEGCLCVFRFYNLVYVDMWMMKEHAVKESWTKLFSVQEPTPTRSFLFLRPLGYSRNGVKLLLEVRREKLVWFDLETNSLRTVKIDTHGLDFVDTEICMASLVPLSD****************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
F-box protein CPR30	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Regulates negatively both salicylic acid (SA)-dependent and SA-independent defense signaling.	probable	Q9SU30

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OVR, chain B
Confidence level:confident
Coverage over the Query: 1-187,198-338
View the alignment between query and template
View the model in PyMOL

Template: 2UVK, chain A
Confidence level:confident
Coverage over the Query: 96-188,200-391
View the alignment between query and template
View the model in PyMOL