Citrus Sinensis ID: 046926
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 226 | ||||||
| 356527993 | 709 | PREDICTED: L-type lectin-domain containi | 0.991 | 0.315 | 0.474 | 5e-54 | |
| 356528003 | 671 | PREDICTED: L-type lectin-domain containi | 0.933 | 0.314 | 0.5 | 2e-53 | |
| 356527997 | 709 | PREDICTED: L-type lectin-domain containi | 0.991 | 0.315 | 0.466 | 1e-52 | |
| 224096774 | 713 | predicted protein [Populus trichocarpa] | 0.924 | 0.293 | 0.490 | 4e-51 | |
| 224059892 | 613 | predicted protein [Populus trichocarpa] | 0.955 | 0.352 | 0.504 | 2e-50 | |
| 224092745 | 681 | predicted protein [Populus trichocarpa] | 0.924 | 0.306 | 0.5 | 3e-50 | |
| 357476157 | 782 | Class I heat shock protein [Medicago tru | 0.969 | 0.280 | 0.482 | 1e-49 | |
| 449479044 | 678 | PREDICTED: L-type lectin-domain containi | 0.982 | 0.327 | 0.431 | 9e-49 | |
| 449438590 | 665 | PREDICTED: LOW QUALITY PROTEIN: L-type l | 0.982 | 0.333 | 0.431 | 1e-48 | |
| 225470605 | 720 | PREDICTED: L-type lectin-domain containi | 0.977 | 0.306 | 0.496 | 1e-47 |
| >gi|356527993|ref|XP_003532590.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 216 bits (550), Expect = 5e-54, Method: Compositional matrix adjust.
Identities = 119/251 (47%), Positives = 159/251 (63%), Gaps = 27/251 (10%)
Query: 1 DNEPLNSSIPFVAVESDVYVNSWDPTFSHVGVDINSVQSKKNA--------------WIS 46
+++ LNS+ PFVAVE D+Y N DP HVG+DINS++S N WIS
Sbjct: 145 EDQRLNSTDPFVAVEFDIYENPDDPPGEHVGIDINSLRSVANVTWLADIKQGKLNEVWIS 204
Query: 47 YNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWE 106
YNSS+ NLSV FTGF N++++ Q L DLRLHLPEFVT GFS ATG+D AI S+ SW+
Sbjct: 205 YNSSSFNLSVVFTGFNNDTILRQHLSAITDLRLHLPEFVTVGFSAATGIDTAIHSVNSWD 264
Query: 107 FNSSLEMDDETIN---------LISN--PKRRRKNRKAPVVGLSLGGGFLVGGVVLIIRL 155
F+S+L + SN P +++KN+ VGLS+GG L+GG+ LI
Sbjct: 265 FSSTLAAQENITKGADTVARYPATSNIAPSQKKKNKTGLAVGLSIGGFVLIGGLGLIS-- 322
Query: 156 AGIGRKRKEGDEEDNQGFSEYIDDKFERGAGPKRFPYKELALATNDFNDDQKLGQGGFGG 215
G+ +K K+G E++ F EY+ + F RGAGP+++ Y EL A N F D+ KLGQGGFGG
Sbjct: 323 IGLWKKWKKGSVEEDLVFEEYMGEDFGRGAGPRKYSYAELTEAANGFKDEHKLGQGGFGG 382
Query: 216 VYKGFLRETNS 226
VYKG+L++ S
Sbjct: 383 VYKGYLKDIKS 393
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356528003|ref|XP_003532595.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356527997|ref|XP_003532592.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224096774|ref|XP_002334671.1| predicted protein [Populus trichocarpa] gi|222874064|gb|EEF11195.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224059892|ref|XP_002300009.1| predicted protein [Populus trichocarpa] gi|222847267|gb|EEE84814.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224092745|ref|XP_002334872.1| predicted protein [Populus trichocarpa] gi|222831889|gb|EEE70366.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357476157|ref|XP_003608364.1| Class I heat shock protein [Medicago truncatula] gi|355509419|gb|AES90561.1| Class I heat shock protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449479044|ref|XP_004155489.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449438590|ref|XP_004137071.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225470605|ref|XP_002262748.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 226 | ||||||
| TAIR|locus:2142499 | 651 | AT5G10530 [Arabidopsis thalian | 0.389 | 0.135 | 0.368 | 2.8e-12 | |
| UNIPROTKB|P58907 | 237 | P58907 "Lectin alpha chain" [D | 0.424 | 0.405 | 0.410 | 6.4e-12 | |
| UNIPROTKB|P81637 | 237 | P81637 "Lectin alpha chain" [D | 0.424 | 0.405 | 0.401 | 8.2e-12 | |
| UNIPROTKB|P58908 | 237 | P58908 "Lectin alpha chain" [D | 0.424 | 0.405 | 0.401 | 1e-11 | |
| UNIPROTKB|P81460 | 237 | P81460 "Concanavalin-A" [Canav | 0.446 | 0.426 | 0.392 | 1.3e-11 | |
| UNIPROTKB|P14894 | 290 | P14894 "Concanavalin-A" [Canav | 0.460 | 0.358 | 0.382 | 2.3e-11 | |
| UNIPROTKB|B3EWJ2 | 237 | B3EWJ2 "Lectin alpha chain" [D | 0.424 | 0.405 | 0.393 | 2.8e-11 | |
| UNIPROTKB|P08902 | 237 | P08902 "Lectin alpha chain" [D | 0.424 | 0.405 | 0.393 | 2.8e-11 | |
| UNIPROTKB|Q40987 | 270 | NLEC1 "Nodule lectin" [Pisum s | 0.469 | 0.392 | 0.36 | 4.9e-11 | |
| UNIPROTKB|Q70DJ5 | 280 | Q70DJ5 "Alpha-methyl-mannoside | 0.442 | 0.357 | 0.345 | 5.7e-11 |
| TAIR|locus:2142499 AT5G10530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 122 (48.0 bits), Expect = 2.8e-12, Sum P(2) = 2.8e-12
Identities = 38/103 (36%), Positives = 53/103 (51%)
Query: 28 SHVGVDINS-VQSKKNAW-------------ISYNSSTHNLSVAFT-GFRNNSVVMQGLD 72
SHVG++ NS V S +W I Y+S+ NLSV++T ++ + L
Sbjct: 156 SHVGINNNSLVSSNYTSWNATSHNQDIGRVLIFYDSARRNLSVSWTYDLTSDPLENSSLS 215
Query: 73 YQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDD 115
Y +DL LP VT GFS +G + SWEF+SSLE+ D
Sbjct: 216 YIIDLSKVLPSEVTIGFSATSGGVTEGNRLLSWEFSSSLELID 258
|
|
| UNIPROTKB|P58907 P58907 "Lectin alpha chain" [Dioclea virgata (taxid:167618)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P81637 P81637 "Lectin alpha chain" [Dioclea guianensis (taxid:99571)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P58908 P58908 "Lectin alpha chain" [Dioclea rostrata (taxid:192416)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P81460 P81460 "Concanavalin-A" [Canavalia lineata (taxid:28957)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P14894 P14894 "Concanavalin-A" [Canavalia gladiata (taxid:3824)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B3EWJ2 B3EWJ2 "Lectin alpha chain" [Dioclea sclerocarpa (taxid:1176036)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P08902 P08902 "Lectin alpha chain" [Dioclea grandiflora (taxid:3837)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q40987 NLEC1 "Nodule lectin" [Pisum sativum (taxid:3888)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q70DJ5 Q70DJ5 "Alpha-methyl-mannoside-specific lectin" [Arachis hypogaea (taxid:3818)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.17120001 | hypothetical protein (713 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 226 | |||
| cd06899 | 236 | cd06899, lectin_legume_LecRK_Arcelin_ConA, legume | 1e-28 | |
| pfam00139 | 231 | pfam00139, Lectin_legB, Legume lectin domain | 6e-18 | |
| cd01951 | 223 | cd01951, lectin_L-type, legume lectins | 6e-09 |
| >gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor | Back alignment and domain information |
|---|
Score = 107 bits (270), Expect = 1e-28
Identities = 47/125 (37%), Positives = 59/125 (47%), Gaps = 19/125 (15%)
Query: 6 NSSIPFVAVESDVYVNSW--DPTFSHVGVDINSVQSKK-----------------NAWIS 46
NSS VAVE D + N DP +HVG+D+NS+ S K AWI
Sbjct: 112 NSSNHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLVSVKAGYWDDDGGKLKSGKPMQAWID 171
Query: 47 YNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWE 106
Y+SS+ LSV L Y VDL LPE V GFS +TG+ + I SW
Sbjct: 172 YDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWS 231
Query: 107 FNSSL 111
F+S+
Sbjct: 232 FSSNG 236
|
This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236 |
| >gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain | Back alignment and domain information |
|---|
| >gnl|CDD|173886 cd01951, lectin_L-type, legume lectins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| cd06899 | 236 | lectin_legume_LecRK_Arcelin_ConA legume lectins, l | 99.96 | |
| PF00139 | 236 | Lectin_legB: Legume lectin domain; InterPro: IPR00 | 99.95 | |
| cd01951 | 223 | lectin_L-type legume lectins. The L-type (legume-t | 99.89 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 98.64 | |
| cd07308 | 218 | lectin_leg-like legume-like lectins: ERGIC-53, ERG | 98.4 | |
| cd06902 | 225 | lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran | 97.94 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.61 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 97.3 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 97.13 | |
| PF08693 | 40 | SKG6: Transmembrane alpha-helix domain; InterPro: | 95.77 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 95.63 | |
| PF03388 | 229 | Lectin_leg-like: Legume-like lectin family; InterP | 95.61 | |
| cd06903 | 215 | lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem | 95.57 | |
| cd06901 | 248 | lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr | 95.56 | |
| KOG3838 | 497 | consensus Mannose lectin ERGIC-53, involved in gly | 94.73 | |
| PF04478 | 154 | Mid2: Mid2 like cell wall stress sensor; InterPro: | 94.72 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 94.71 | |
| PF14575 | 75 | EphA2_TM: Ephrin type-A receptor 2 transmembrane d | 94.47 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 93.99 | |
| PTZ00382 | 96 | Variant-specific surface protein (VSP); Provisiona | 93.84 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 93.79 | |
| KOG3839 | 351 | consensus Lectin VIP36, involved in the transport | 93.49 | |
| PF06697 | 278 | DUF1191: Protein of unknown function (DUF1191); In | 90.96 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 90.68 | |
| PF15102 | 146 | TMEM154: TMEM154 protein family | 87.65 | |
| PTZ00284 | 467 | protein kinase; Provisional | 86.96 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 86.87 | |
| KOG1024 | 563 | consensus Receptor-like protein tyrosine kinase RY | 86.6 | |
| PF15065 | 350 | NCU-G1: Lysosomal transcription factor, NCU-G1 | 86.48 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 85.88 | |
| PF01102 | 122 | Glycophorin_A: Glycophorin A; InterPro: IPR001195 | 85.68 | |
| PF03302 | 397 | VSP: Giardia variant-specific surface protein; Int | 85.65 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 83.01 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 82.39 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 81.54 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 81.52 | |
| PF12877 | 684 | DUF3827: Domain of unknown function (DUF3827); Int | 80.8 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 80.65 |
| >cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor | Back alignment and domain information |
|---|
Probab=99.96 E-value=1.2e-29 Score=209.15 Aligned_cols=105 Identities=45% Similarity=0.595 Sum_probs=97.3
Q ss_pred CCCCCeEEEEEecccCC--CCCCCCeeEEEcCCCCccc-----------------eEEEEEcCCCcEEEEEEEeCCCCCc
Q 046926 6 NSSIPFVAVESDVYVNS--WDPTFSHVGVDINSVQSKK-----------------NAWISYNSSTHNLSVAFTGFRNNSV 66 (226)
Q Consensus 6 ~~~~~~~avefdt~~n~--~d~~~~hvgi~~n~~~s~~-----------------~~~i~y~~~~~~l~v~~~~~~~~~~ 66 (226)
.+.+++|||||||++|. +||++||||||+|++.|.. +|||+||+.+++|+|+|.+....+|
T Consensus 112 ~~~~~~vAVEFDT~~n~~~~D~~~nHigIdvn~~~S~~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~ 191 (236)
T cd06899 112 NSSNHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLVSVKAGYWDDDGGKLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKP 191 (236)
T ss_pred CcccceEEEEeecccCcccCCCCCCeEEEEcCCcccceeeccccccccccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCC
Confidence 46789999999999997 3999999999999987643 7999999999999999998877789
Q ss_pred ccceeEEEeccccCCCcceEeeEeeecccccceeecccccccCC
Q 046926 67 VMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSS 110 (226)
Q Consensus 67 ~~~~l~~~~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~f~s~ 110 (226)
..|+|+..+||+.+||++|||||+|+||...+.|+|++|+|+++
T Consensus 192 ~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s~ 235 (236)
T cd06899 192 KKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSN 235 (236)
T ss_pred cCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEcC
Confidence 99999999999999999999999999999999999999999875
|
This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin |
| >PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported | Back alignment and domain information |
|---|
| >cd01951 lectin_L-type legume lectins | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 | Back alignment and domain information |
|---|
| >cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates | Back alignment and domain information |
|---|
| >cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain | Back alignment and domain information |
|---|
| >KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF14575 EphA2_TM: Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >PTZ00382 Variant-specific surface protein (VSP); Provisional | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF06697 DUF1191: Protein of unknown function (DUF1191); InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15102 TMEM154: TMEM154 protein family | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15065 NCU-G1: Lysosomal transcription factor, NCU-G1 | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane | Back alignment and domain information |
|---|
| >PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >PF12877 DUF3827: Domain of unknown function (DUF3827); InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ] | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 226 | ||||
| 1n3o_A | 252 | Pterocarcpus Angolensis Lectin In Complex With Alph | 6e-13 | ||
| 1q8o_A | 252 | Pterocartpus Angolensis Lectin Pal In Complex With | 6e-13 | ||
| 1n47_A | 233 | Isolectin B4 From Vicia Villosa In Complex With The | 2e-12 | ||
| 3zvx_A | 261 | Structure Of The Lectin From Platypodium Elegans In | 6e-12 | ||
| 1wbl_A | 241 | Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga | 1e-11 | ||
| 1wbf_A | 242 | Winged Bean Lectin, Saccharide Free Form Length = 2 | 1e-11 | ||
| 2sba_A | 253 | Soybean Agglutinin Complexed With 2,6-Pentasacchari | 2e-11 | ||
| 2e7q_A | 237 | Crystal Structure Of Basic Winged Bean Lectin In Co | 2e-11 | ||
| 3rrd_A | 237 | Native Structure Of Dioclea Virgata Lectin Length = | 3e-11 | ||
| 1h9w_A | 237 | Native Dioclea Guianensis Seed Lectin Length = 237 | 3e-11 | ||
| 1h9p_A | 237 | Crystal Structure Of Dioclea Guianensis Seed Lectin | 3e-11 | ||
| 1qmo_E | 133 | Structure Of Fril, A Legume Lectin That Delays Hema | 4e-11 | ||
| 2zbj_A | 237 | Crystal Structure Of Dioclea Rostrata Lectin Length | 6e-11 | ||
| 2jdz_A | 239 | Crystal Structure Of Recombinant Dioclea Guianensis | 8e-11 | ||
| 2je7_A | 239 | Crystal Structure Of Recombinant Dioclea Guianensis | 9e-11 | ||
| 1fny_A | 237 | Legume Lectin Of The Bark Of Robinia Pseudoacacia. | 1e-10 | ||
| 2bqp_A | 234 | The Structure Of The Pea Lectin-D-Glucopyranose Com | 2e-10 | ||
| 2jec_A | 239 | Crystal Structure Of Recombinant Dioclea Grandiflor | 2e-10 | ||
| 2gdf_A | 237 | Crystal Structure Of Dioclea Violacea Seed Lectin L | 2e-10 | ||
| 2je9_A | 239 | Crystal Structure Of Recombinant Dioclea Grandiflor | 2e-10 | ||
| 3sh3_A | 237 | Crystal Structure Of A Pro-Inflammatory Lectin From | 2e-10 | ||
| 3a0k_A | 237 | Crystal Structure Of An Antiflamatory Legume Lectin | 2e-10 | ||
| 1lul_A | 253 | Db58, A Legume Lectin From Dolichos Biflorus Length | 3e-10 | ||
| 1qnw_A | 242 | Lectin Ii From Ulex Europaeus Length = 242 | 3e-10 | ||
| 1azd_A | 237 | Concanavalin From Canavalia Brasiliensis Length = 2 | 3e-10 | ||
| 2ow4_A | 237 | Crystal Structure Of A Lectin From Canavalia Mariti | 3e-10 | ||
| 2cwm_A | 237 | Native Crystal Structure Of No Releasing Inductive | 3e-10 | ||
| 1cn1_A | 237 | Crystal Structure Of Demetallized Concanavalin A. T | 4e-10 | ||
| 2cna_A | 237 | The Covalent And Three-Dimensional Structure Of Con | 4e-10 | ||
| 2ctv_A | 237 | High Resolution Crystallographic Studies Of Native | 4e-10 | ||
| 2yz4_A | 237 | The Neutron Structure Of Concanavalin A At 2.2 Angs | 5e-10 | ||
| 2eig_A | 234 | Lotus Tetragonolobus Seed Lectin (Isoform) Length = | 5e-10 | ||
| 1wuv_A | 237 | Crystal Structure Of Native Canavalia Gladiata Lect | 5e-10 | ||
| 3u4x_A | 236 | Crystal Structure Of A Lectin From Camptosema Pedic | 6e-10 | ||
| 2ovu_A | 237 | Crystal Strucure Of A Lectin From Canavalia Gladiat | 6e-10 | ||
| 1bjq_A | 253 | The Dolichos Biflorus Seed Lectin In Complex With A | 7e-10 | ||
| 3ujo_A | 281 | Galactose-Specific Seed Lectin From Dolichos Lablab | 8e-10 | ||
| 2pel_A | 236 | Peanut Lectin Length = 236 | 8e-10 | ||
| 1mvq_A | 236 | Cratylia Mollis Lectin (Isoform 1) In Complex With | 8e-10 | ||
| 1dgl_A | 237 | Lectin From Dioclea Grandiflora Complexed To Triman | 8e-10 | ||
| 1bzw_A | 232 | Peanut Lectin Complexed With C-Lactose Length = 232 | 1e-09 | ||
| 2d3p_A | 236 | Cratylia Floribunda Seed Lectin Crystallized At Bas | 1e-09 | ||
| 1fat_A | 252 | Phytohemagglutinin-L Length = 252 | 1e-09 | ||
| 3usu_B | 242 | Crystal Structure Of Butea Monosperma Seed Lectin L | 4e-09 | ||
| 3usu_A | 256 | Crystal Structure Of Butea Monosperma Seed Lectin L | 5e-09 | ||
| 2fmd_A | 240 | Structural Basis Of Carbohydrate Recognition By Bow | 7e-09 | ||
| 1g8w_A | 233 | Improved Structure Of Phytohemagglutinin-L From The | 8e-09 | ||
| 1fay_A | 238 | Winged Bean Acidic Lectin Complexed With Methyl-Alp | 2e-08 | ||
| 1dbn_A | 239 | Maackia Amurensis Leukoagglutinin (Lectin) With Sia | 3e-08 | ||
| 1uzy_A | 242 | Erythrina Crystagalli Lectin Length = 242 | 1e-07 | ||
| 1fyu_A | 255 | Crystal Structure Of Erythrina Corallodendron Lecti | 1e-07 | ||
| 3n35_A | 242 | Erythrina Corallodendron Lectin Mutant (Y106g) With | 2e-07 | ||
| 1sfy_A | 239 | Crystal Structure Of Recombinant Erythrina Corallod | 3e-07 | ||
| 1lte_A | 239 | Structure Of A Legume Lectin With An Ordered N-Link | 3e-07 | ||
| 1ax0_A | 239 | Erythrina Corallodendron Lectin In Complex With N-A | 3e-07 | ||
| 1gz9_A | 239 | High-Resolution Crystal Structure Of Erythrina Cris | 3e-07 | ||
| 1fx5_A | 242 | Crystal Structure Analysis Of Ulex Europaeus Lectin | 8e-07 | ||
| 3ipv_A | 251 | Crystal Structure Of Spatholobus Parviflorus Seed L | 1e-06 | ||
| 3ipv_B | 239 | Crystal Structure Of Spatholobus Parviflorus Seed L | 1e-06 | ||
| 1gsl_A | 243 | Lectin (Fourth Isolated From (Griffonia Simplicifol | 2e-06 | ||
| 1gnz_A | 257 | Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)m | 2e-06 | ||
| 1hql_A | 257 | The Xenograft Antigen In Complex With The B4 Isolec | 2e-06 |
| >pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 | Back alignment and structure |
|
| >pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 | Back alignment and structure |
| >pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 | Back alignment and structure |
| >pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 | Back alignment and structure |
| >pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 | Back alignment and structure |
| >pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 | Back alignment and structure |
| >pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 | Back alignment and structure |
| >pdb|2E7Q|A Chain A, Crystal Structure Of Basic Winged Bean Lectin In Complex With B Blood Group Trisaccharide Length = 237 | Back alignment and structure |
| >pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 | Back alignment and structure |
| >pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 | Back alignment and structure |
| >pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 | Back alignment and structure |
| >pdb|1QMO|E Chain E, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 133 | Back alignment and structure |
| >pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 | Back alignment and structure |
| >pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|1FNY|A Chain A, Legume Lectin Of The Bark Of Robinia Pseudoacacia. Length = 237 | Back alignment and structure |
| >pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 | Back alignment and structure |
| >pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 | Back alignment and structure |
| >pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 | Back alignment and structure |
| >pdb|3A0K|A Chain A, Crystal Structure Of An Antiflamatory Legume Lectin From Cymbosema Roseum Seeds Length = 237 | Back alignment and structure |
| >pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 | Back alignment and structure |
| >pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 | Back alignment and structure |
| >pdb|1AZD|A Chain A, Concanavalin From Canavalia Brasiliensis Length = 237 | Back alignment and structure |
| >pdb|2OW4|A Chain A, Crystal Structure Of A Lectin From Canavalia Maritima Seeds (Conm) In Complex With Man1-2man-Ome Length = 237 | Back alignment and structure |
| >pdb|2CWM|A Chain A, Native Crystal Structure Of No Releasing Inductive Lectin From Seeds Of The Canavalia Maritima (Conm) Length = 237 | Back alignment and structure |
| >pdb|1CN1|A Chain A, Crystal Structure Of Demetallized Concanavalin A. The Metal- Binding Region Length = 237 | Back alignment and structure |
| >pdb|2CNA|A Chain A, The Covalent And Three-Dimensional Structure Of Concanavalin A, Iv.Atomic Coordinates,Hydrogen Bonding,And Quaternary Structure Length = 237 | Back alignment and structure |
| >pdb|2CTV|A Chain A, High Resolution Crystallographic Studies Of Native Concanavalin A Using Rapid Laue Data Collection Methods And The Introduction Of A Monochromatic Large-Angle Oscillation Technique (Lot) Length = 237 | Back alignment and structure |
| >pdb|2YZ4|A Chain A, The Neutron Structure Of Concanavalin A At 2.2 Angstroms Length = 237 | Back alignment and structure |
| >pdb|2EIG|A Chain A, Lotus Tetragonolobus Seed Lectin (Isoform) Length = 234 | Back alignment and structure |
| >pdb|1WUV|A Chain A, Crystal Structure Of Native Canavalia Gladiata Lectin (Cgl): A Tetrameric Cona-Like Lectin Length = 237 | Back alignment and structure |
| >pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 | Back alignment and structure |
| >pdb|2OVU|A Chain A, Crystal Strucure Of A Lectin From Canavalia Gladiata (Cgl) In Complex With Man1-2man-Ome Length = 237 | Back alignment and structure |
| >pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 | Back alignment and structure |
| >pdb|3UJO|A Chain A, Galactose-Specific Seed Lectin From Dolichos Lablab In Complex With Adenine And Galactose Length = 281 | Back alignment and structure |
| >pdb|2PEL|A Chain A, Peanut Lectin Length = 236 | Back alignment and structure |
| >pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 | Back alignment and structure |
| >pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 | Back alignment and structure |
| >pdb|1BZW|A Chain A, Peanut Lectin Complexed With C-Lactose Length = 232 | Back alignment and structure |
| >pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 | Back alignment and structure |
| >pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 | Back alignment and structure |
| >pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 | Back alignment and structure |
| >pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 | Back alignment and structure |
| >pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 | Back alignment and structure |
| >pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 | Back alignment and structure |
| >pdb|1FAY|A Chain A, Winged Bean Acidic Lectin Complexed With Methyl-Alpha-D-Galactose (Monoclinic Form) Length = 238 | Back alignment and structure |
| >pdb|1DBN|A Chain A, Maackia Amurensis Leukoagglutinin (Lectin) With Sialyllactose Length = 239 | Back alignment and structure |
| >pdb|1UZY|A Chain A, Erythrina Crystagalli Lectin Length = 242 | Back alignment and structure |
| >pdb|1FYU|A Chain A, Crystal Structure Of Erythrina Corallodendron Lectin In Hexagonal Crystal Form Length = 255 | Back alignment and structure |
| >pdb|3N35|A Chain A, Erythrina Corallodendron Lectin Mutant (Y106g) With N- Acetylgalactosamine Length = 242 | Back alignment and structure |
| >pdb|1SFY|A Chain A, Crystal Structure Of Recombinant Erythrina Corallodandron Lectin Length = 239 | Back alignment and structure |
| >pdb|1LTE|A Chain A, Structure Of A Legume Lectin With An Ordered N-Linked Carbohydrate In Complex With Lactose Length = 239 | Back alignment and structure |
| >pdb|1AX0|A Chain A, Erythrina Corallodendron Lectin In Complex With N-Actylgalactosamine Length = 239 | Back alignment and structure |
| >pdb|1GZ9|A Chain A, High-Resolution Crystal Structure Of Erythrina Cristagalli Lectin In Complex With 2'-Alpha-L-Fucosyllactose Length = 239 | Back alignment and structure |
| >pdb|1FX5|A Chain A, Crystal Structure Analysis Of Ulex Europaeus Lectin I Length = 242 | Back alignment and structure |
| >pdb|3IPV|A Chain A, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 251 | Back alignment and structure |
| >pdb|3IPV|B Chain B, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 239 | Back alignment and structure |
| >pdb|1GSL|A Chain A, Lectin (Fourth Isolated From (Griffonia Simplicifolia)) Complex With Y Human Blood Group Determinant Length = 243 | Back alignment and structure |
| >pdb|1GNZ|A Chain A, Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)metal Free Form Length = 257 | Back alignment and structure |
| >pdb|1HQL|A Chain A, The Xenograft Antigen In Complex With The B4 Isolectin Of Griffonia Simplicifolia Lectin-1 Length = 257 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 226 | |||
| 1v6i_A | 232 | Agglutinin, PNA, galactose-binding lectin; open qu | 3e-20 | |
| 1qmo_E | 133 | Mannose binding lectin, FRIL; crosslink, hematopoi | 4e-20 | |
| 2fmd_A | 240 | Lectin, agglutinin, BMA; legume lectin, beta sandw | 3e-19 | |
| 3zyr_A | 261 | Lectin; sugar binding protein, N-glycan; HET: NAG | 3e-19 | |
| 1n47_A | 233 | Isolectin B4; cancer antigen, vicia villosa lectin | 4e-19 | |
| 1wbf_A | 242 | Protein (agglutinin); lectin (agglutinin), legume | 5e-19 | |
| 1fny_A | 237 | BARK lectin, BARK agglutinin I,polypeptide A; legu | 9e-19 | |
| 1g7y_A | 253 | Stem/LEAF lectin DB58; jelly roll fold, sugar bind | 2e-18 | |
| 2eig_A | 234 | Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin | 6e-18 | |
| 1f9k_A | 238 | Acidic lectin; legume lectin, glycosylated protein | 1e-17 | |
| 1fx5_A | 242 | UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO | 1e-17 | |
| 3ipv_A | 251 | Lectin alpha chain; galactose binding, SEED lectin | 2e-17 | |
| 1qnw_A | 242 | Chitin binding lectin, UEA-II; carbohydrate bindin | 4e-17 | |
| 1sbf_A | 253 | Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G | 4e-17 | |
| 1fat_A | 252 | Phytohemagglutinin-L; glycoprotein, plant defense | 6e-17 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 6e-17 | |
| 1gzc_A | 239 | Erythrina crista-galli lectin; carbohydrate, sugar | 6e-17 | |
| 1ioa_A | 240 | Arcelin-5A, ARC5A; lectin-like proteins, plant def | 8e-17 | |
| 1dbn_A | 239 | MAL, protein (leukoagglutinin); plant lectin, carb | 2e-16 | |
| 1gsl_A | 243 | Griffonia simplicifolia lectin 4; glycoprotein, ma | 1e-15 | |
| 1hql_A | 257 | Lectin; xenograft antigen, sugar BI protein; HET: | 1e-15 | |
| 2bqp_A | 234 | Protein (PEA lectin); D-glucopyranose complex, sug | 5e-15 | |
| 1dhk_B | 223 | Bean lectin-like inhibitor, porcine pancreatic alp | 2e-14 | |
| 1avb_A | 226 | Arcelin-1; lectin-like glycoprotein, plant defense | 6e-14 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 1e-12 | |
| 2ltn_B | 52 | PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP | 3e-12 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 7e-12 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 5e-11 | |
| 2ltn_A | 181 | PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO | 2e-07 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 1e-05 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 4e-05 | |
| 1gv9_A | 260 | P58/ergic-53; lectin, carbohydrate binding; 1.46A | 3e-04 |
| >1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 | Back alignment and structure |
|---|
Score = 84.4 bits (208), Expect = 3e-20
Identities = 46/122 (37%), Positives = 57/122 (46%), Gaps = 18/122 (14%)
Query: 6 NSSIPFVAVESDVYVNSW--DPTFSHVGVDINSVQSKK------------NAWISYNSST 51
+ FV VE D Y NS DP HVG+D+NSV S K + Y+SST
Sbjct: 112 KGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSST 171
Query: 52 HNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVD-FAIFSIYSWEFNSS 110
LSVA T + + VDL+ LPE V FGFS + + I I SW F S+
Sbjct: 172 KTLSVAVTNDNGDITT---IAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTST 228
Query: 111 LE 112
L
Sbjct: 229 LI 230
|
| >1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 | Back alignment and structure |
|---|
| >2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 | Back alignment and structure |
|---|
| >3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 | Back alignment and structure |
|---|
| >1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 | Back alignment and structure |
|---|
| >1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 | Back alignment and structure |
|---|
| >1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 | Back alignment and structure |
|---|
| >1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 | Back alignment and structure |
|---|
| >2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 | Back alignment and structure |
|---|
| >1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 | Back alignment and structure |
|---|
| >1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 | Back alignment and structure |
|---|
| >3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 | Back alignment and structure |
|---|
| >1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 | Back alignment and structure |
|---|
| >1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 | Back alignment and structure |
|---|
| >1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 | Back alignment and structure |
|---|
| >1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 | Back alignment and structure |
|---|
| >1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 | Back alignment and structure |
|---|
| >1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 | Back alignment and structure |
|---|
| >1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 | Back alignment and structure |
|---|
| >1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 | Back alignment and structure |
|---|
| >2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 | Back alignment and structure |
|---|
| >1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 | Back alignment and structure |
|---|
| >1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
| >2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Length = 181 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| 1qmo_E | 133 | Mannose binding lectin, FRIL; crosslink, hematopoi | 100.0 | |
| 3ujo_A | 281 | Legume lectin; carbohydrate-binding, galactose, ad | 100.0 | |
| 3ipv_A | 251 | Lectin alpha chain; galactose binding, SEED lectin | 100.0 | |
| 3zyr_A | 261 | Lectin; sugar binding protein, N-glycan; HET: NAG | 100.0 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 100.0 | |
| 1fny_A | 237 | BARK lectin, BARK agglutinin I,polypeptide A; legu | 100.0 | |
| 1dbn_A | 239 | MAL, protein (leukoagglutinin); plant lectin, carb | 100.0 | |
| 1sbf_A | 253 | Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G | 100.0 | |
| 1n47_A | 233 | Isolectin B4; cancer antigen, vicia villosa lectin | 100.0 | |
| 1qnw_A | 242 | Chitin binding lectin, UEA-II; carbohydrate bindin | 100.0 | |
| 1fx5_A | 242 | UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO | 100.0 | |
| 2eig_A | 234 | Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin | 100.0 | |
| 1gzc_A | 239 | Erythrina crista-galli lectin; carbohydrate, sugar | 100.0 | |
| 2bqp_A | 234 | Protein (PEA lectin); D-glucopyranose complex, sug | 99.98 | |
| 1hql_A | 257 | Lectin; xenograft antigen, sugar BI protein; HET: | 99.98 | |
| 1wbf_A | 242 | Protein (agglutinin); lectin (agglutinin), legume | 99.98 | |
| 1fat_A | 252 | Phytohemagglutinin-L; glycoprotein, plant defense | 99.98 | |
| 1g7y_A | 253 | Stem/LEAF lectin DB58; jelly roll fold, sugar bind | 99.98 | |
| 1f9k_A | 238 | Acidic lectin; legume lectin, glycosylated protein | 99.98 | |
| 1v6i_A | 232 | Agglutinin, PNA, galactose-binding lectin; open qu | 99.97 | |
| 2fmd_A | 240 | Lectin, agglutinin, BMA; legume lectin, beta sandw | 99.97 | |
| 1gsl_A | 243 | Griffonia simplicifolia lectin 4; glycoprotein, ma | 99.97 | |
| 1ioa_A | 240 | Arcelin-5A, ARC5A; lectin-like proteins, plant def | 99.96 | |
| 1avb_A | 226 | Arcelin-1; lectin-like glycoprotein, plant defense | 99.96 | |
| 1dhk_B | 223 | Bean lectin-like inhibitor, porcine pancreatic alp | 99.95 | |
| 2ltn_A | 181 | PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO | 99.81 | |
| 1gv9_A | 260 | P58/ergic-53; lectin, carbohydrate binding; 1.46A | 99.75 | |
| 2dur_A | 253 | VIP36;, vesicular integral-membrane protein VIP36; | 99.73 | |
| 2ltn_B | 52 | PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP | 99.49 | |
| 2a6y_A | 256 | EMP47P (FORM1); beta sandwich, carbohydrate bindin | 99.21 | |
| 2a6z_A | 222 | EMP47P (FORM2); beta sandwich, carbohydrate bindin | 98.1 | |
| 2a6v_A | 226 | EMP46P; beta sandwich, carbohydrate binding protei | 95.84 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 95.47 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 94.87 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 94.79 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 93.74 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 93.7 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 92.84 | |
| 2ks1_B | 44 | Epidermal growth factor receptor; ERBB1, ERBB2, tr | 92.47 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 91.97 | |
| 2l2t_A | 44 | Receptor tyrosine-protein kinase ERBB-4; transmemb | 91.12 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 90.86 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 89.77 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 89.34 | |
| 2jwa_A | 44 | Receptor tyrosine-protein kinase ERBB-2; transmemb | 89.33 | |
| 2k1k_A | 38 | Ephrin type-A receptor 1; EPHA1, receptor tyrosine | 88.84 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 88.06 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 87.92 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 87.79 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 87.59 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 86.07 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 85.3 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 85.1 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 85.02 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 84.92 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 84.61 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 83.73 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 83.0 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 82.8 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 82.69 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 82.36 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 82.23 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 82.06 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 80.94 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 80.89 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 80.85 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 80.83 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 80.7 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 80.36 |
| >1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-37 Score=231.25 Aligned_cols=101 Identities=43% Similarity=0.613 Sum_probs=94.1
Q ss_pred CCeEEEEEecccCC--CCCCCCeeEEEcCCCCccc------------eEEEEEcCCCcEEEEEEEeCCCCCcccceeEEE
Q 046926 9 IPFVAVESDVYVNS--WDPTFSHVGVDINSVQSKK------------NAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQ 74 (226)
Q Consensus 9 ~~~~avefdt~~n~--~d~~~~hvgi~~n~~~s~~------------~~~i~y~~~~~~l~v~~~~~~~~~~~~~~l~~~ 74 (226)
||+|||||||++|. |||++||||||+||+.|.+ +|||+||+.+++|+|+|++.+. + .|+|+..
T Consensus 1 n~~vAVEFDT~~N~e~~Dp~~nHVGIdvNsi~S~~s~~~~l~sG~~~~v~I~Yd~~~~~L~V~l~~~~~-~--~p~ls~~ 77 (133)
T 1qmo_E 1 SNVVAVEFDTYLNPDYGDPNYIHIGIDVNSIRSKVTAKWDWQNGKIATAHISYNSVSKRLSVTSYYAGS-K--PATLSYD 77 (133)
T ss_dssp CCCEEEEEECSCCGGGTCCSSCEEEEEESSSSCSEEEECCCCTTSCEEEEEEEETTTTEEEEEEECSSS-C--CEEEEEE
T ss_pred CCEEEEEEeCCcCccccCCCCCeeEEecccccccceeeeEEcCCCEEEEEEEEeCCCcEEEEEEccCCC-c--cceEEEe
Confidence 68999999999997 9999999999999998765 8999999999999999998764 3 7999999
Q ss_pred eccccCCCcceEeeEeeecccccceeecccccccCCCc
Q 046926 75 VDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLE 112 (226)
Q Consensus 75 ~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~f~s~~~ 112 (226)
+||+.+||++|||||+|+||...+.|+|++|+|++.+.
T Consensus 78 vdLs~~l~e~v~VGFSAsTG~~~~~h~IlsWsF~s~l~ 115 (133)
T 1qmo_E 78 IELHTVLPEWVRVGLSASTGQDKERNTVHSWSFTSSLW 115 (133)
T ss_dssp CCGGGTSCSEEEEEEEEECSSSCCEEEEEEEEEEEEEE
T ss_pred echHHhccccEEEEEEeccCCCcceeEEEEEEEEeeCC
Confidence 99999999999999999999999999999999998764
|
| >3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* | Back alignment and structure |
|---|
| >3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* | Back alignment and structure |
|---|
| >3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... | Back alignment and structure |
|---|
| >1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* | Back alignment and structure |
|---|
| >1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* | Back alignment and structure |
|---|
| >1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* | Back alignment and structure |
|---|
| >1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* | Back alignment and structure |
|---|
| >2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} | Back alignment and structure |
|---|
| >1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* | Back alignment and structure |
|---|
| >2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* | Back alignment and structure |
|---|
| >1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* | Back alignment and structure |
|---|
| >1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* | Back alignment and structure |
|---|
| >1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* | Back alignment and structure |
|---|
| >1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* | Back alignment and structure |
|---|
| >1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... | Back alignment and structure |
|---|
| >2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} | Back alignment and structure |
|---|
| >1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* | Back alignment and structure |
|---|
| >1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* | Back alignment and structure |
|---|
| >2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* | Back alignment and structure |
|---|
| >1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A | Back alignment and structure |
|---|
| >2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* | Back alignment and structure |
|---|
| >2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B | Back alignment and structure |
|---|
| >2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 | Back alignment and structure |
|---|
| >2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A | Back alignment and structure |
|---|
| >2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A | Back alignment and structure |
|---|
| >2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 226 | ||||
| d1nlsa_ | 237 | b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia | 1e-22 | |
| d2d3sa1 | 237 | b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso | 1e-21 | |
| d1f9ka_ | 234 | b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca | 5e-21 | |
| g1qmo.1 | 230 | b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich | 2e-20 | |
| d1gzca_ | 239 | b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( | 2e-20 | |
| d1qnwa_ | 237 | b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus | 2e-20 | |
| d1g9fa_ | 251 | b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) | 4e-20 | |
| d1n47a_ | 233 | b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi | 6e-20 | |
| d1v6ia_ | 232 | b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog | 9e-20 | |
| d1ukga_ | 241 | b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero | 1e-19 | |
| d1fx5a_ | 240 | b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus | 2e-19 | |
| d1hqla_ | 236 | b.29.1.1 (A:) Legume lectin {Griffonia simplicifol | 3e-19 | |
| d1g7ya_ | 253 | b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos | 9e-19 | |
| d1g8wa_ | 233 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 2e-18 | |
| d1leda_ | 243 | b.29.1.1 (A:) Legume lectin {West-central african | 4e-17 | |
| d1fnya_ | 237 | b.29.1.1 (A:) Legume lectin {Black locust (Robinia | 1e-16 | |
| d1ioaa_ | 228 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 5e-16 | |
| d1avba_ | 226 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 1e-15 | |
| d1dbna_ | 239 | b.29.1.1 (A:) Legume lectin {Maackia amurensis, le | 4e-15 | |
| g2ltn.1 | 229 | b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum | 6e-15 | |
| d1dhkb_ | 204 | b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar | 3e-12 | |
| d1gv9a_ | 228 | b.29.1.13 (A:) Carbohydrate-recognition domain of | 3e-09 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 1e-06 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 2e-06 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 9e-06 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 5e-05 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 7e-05 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 5e-04 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 7e-04 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 7e-04 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 7e-04 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 8e-04 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 8e-04 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 0.001 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 0.001 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 0.002 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 0.002 | |
| d2a6va1 | 218 | b.29.1.13 (A:9-226) Emp46p N-terminal domain {Bake | 0.003 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 0.003 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 0.003 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 0.003 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 0.004 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 0.004 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 0.004 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 0.004 |
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Legume lectins domain: Concanavalin A species: Jack bean (Canavalia ensiformis) [TaxId: 3823]
Score = 90.0 bits (223), Expect = 1e-22
Identities = 44/127 (34%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
Query: 11 FVAVESDVYVNS--WDPTFSHVGVDINSVQSKK------------NAWISYNSSTHNLSV 56
VAVE D Y N+ DP++ H+G+DI SV+SKK A I YNS LS
Sbjct: 4 IVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTAHIIYNSVDKRLSA 63
Query: 57 AFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDE 116
+ +S + Y VDL LPE+V G S +TG+ +I SW F S L+ +
Sbjct: 64 VVSYPNADSAT---VSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKSNST 120
Query: 117 TINLISN 123
+
Sbjct: 121 HETNALH 127
|
| >d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 | Back information, alignment and structure |
|---|
| >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 | Back information, alignment and structure |
|---|
| >d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 | Back information, alignment and structure |
|---|
| >d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 | Back information, alignment and structure |
|---|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 | Back information, alignment and structure |
|---|
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 | Back information, alignment and structure |
|---|
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 | Back information, alignment and structure |
|---|
| >d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 | Back information, alignment and structure |
|---|
| >d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 | Back information, alignment and structure |
|---|
| >d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 | Back information, alignment and structure |
|---|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 226 | |||
| d1nlsa_ | 237 | Concanavalin A {Jack bean (Canavalia ensiformis) [ | 99.97 | |
| d1hqla_ | 236 | Legume lectin {Griffonia simplicifolia, lectin I-b | 99.97 | |
| d1leda_ | 243 | Legume lectin {West-central african legume (Griffo | 99.97 | |
| d2d3sa1 | 237 | Legume lectin {Winged bean (Psophocarpus tetragono | 99.97 | |
| d1fx5a_ | 240 | Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI | 99.96 | |
| d1qnwa_ | 237 | Legume lectin {Furze (Ulex europaeus), UEA-II [Tax | 99.96 | |
| d1gzca_ | 239 | Legume lectin {Cockspur coral tree (Erythrina cris | 99.96 | |
| d1f9ka_ | 234 | Legume lectin {Winged bean (Psophocarpus tetragono | 99.96 | |
| d1g9fa_ | 251 | Legume lectin {Soybean (Glycine max) [TaxId: 3847] | 99.96 | |
| d1g7ya_ | 253 | Legume lectin {Horse gram (Dolichos biflorus), dif | 99.95 | |
| d1n47a_ | 233 | Legume lectin {Hairy vetch (Vicia villosa), isolec | 99.95 | |
| d1ukga_ | 241 | Legume lectin {Bloodwood tree (Pterocarpus angolen | 99.95 | |
| d1g8wa_ | 233 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.95 | |
| d1fnya_ | 237 | Legume lectin {Black locust (Robinia pseudoacacia) | 99.94 | |
| d1v6ia_ | 232 | Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 | 99.94 | |
| g1qmo.1 | 230 | Legume lectin {Field bean (Dolichos lablab), Fril | 99.94 | |
| d1dbna_ | 239 | Legume lectin {Maackia amurensis, leukoagglutinin | 99.94 | |
| d1ioaa_ | 228 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.9 | |
| g2ltn.1 | 229 | Legume lectin {Garden pea (Pisum sativum) [TaxId: | 99.89 | |
| d1dhkb_ | 204 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.86 | |
| d1avba_ | 226 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.86 | |
| d1gv9a_ | 228 | Carbohydrate-recognition domain of P58/ERGIC-53 {R | 99.41 | |
| d2a6va1 | 218 | Emp46p N-terminal domain {Baker's yeast (Saccharom | 98.36 | |
| d2a6za1 | 221 | Emp47p N-terminal domain {Baker's yeast (Saccharom | 98.11 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 91.41 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 86.44 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 86.36 |
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Legume lectins domain: Concanavalin A species: Jack bean (Canavalia ensiformis) [TaxId: 3823]
Probab=99.97 E-value=4.8e-32 Score=218.94 Aligned_cols=104 Identities=41% Similarity=0.603 Sum_probs=95.8
Q ss_pred CCCeEEEEEecccCC--CCCCCCeeEEEcCCCCccc------------eEEEEEcCCCcEEEEEEEeCCCCCcccceeEE
Q 046926 8 SIPFVAVESDVYVNS--WDPTFSHVGVDINSVQSKK------------NAWISYNSSTHNLSVAFTGFRNNSVVMQGLDY 73 (226)
Q Consensus 8 ~~~~~avefdt~~n~--~d~~~~hvgi~~n~~~s~~------------~~~i~y~~~~~~l~v~~~~~~~~~~~~~~l~~ 73 (226)
.|++|||||||++|. |||++||||||+|++.|.. +|||+||+.+++|.|++.+. ++..|+|++
T Consensus 1 an~ivAVEFDT~~N~~~~Dp~~nHIgIdvns~~S~~~~~~~l~~G~~~~v~I~Yd~~~~~L~V~~~~~---~~~~~~ls~ 77 (237)
T d1nlsa_ 1 ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTAHIIYNSVDKRLSAVVSYP---NADSATVSY 77 (237)
T ss_dssp CCCEEEEEEECSCCGGGTCCSSCEEEEEESSSSCSEEEECCCCTTCEEEEEEEEETTTTEEEEEEECT---TSCCEEEEE
T ss_pred CCCEEEEEEECCcCCCCCCCCCCEEEEEeCCCCccceecccccCCCEEEEEEEEecCCcEEEEEEecC---CCCCeEEEE
Confidence 489999999999996 8999999999999998854 89999999999999999763 567889999
Q ss_pred EeccccCCCcceEeeEeeecccccceeecccccccCCCccc
Q 046926 74 QVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMD 114 (226)
Q Consensus 74 ~~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~f~s~~~~~ 114 (226)
.+||+.+|+++||+||+|+||...+.|+|++|+|++++...
T Consensus 78 ~vdL~~~l~~~vyvGFSAsTG~~~~~h~I~sWsFsS~~~~~ 118 (237)
T d1nlsa_ 78 DVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKSN 118 (237)
T ss_dssp ECCGGGTSCSEEEEEEEEECSSSCCCCEEEEEEEEEEEEES
T ss_pred EEChHHhCCCcEEEEEEeecCCCccceEEEEEEEEeecccc
Confidence 99999999999999999999999999999999999876544
|
| >d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} | Back information, alignment and structure |
|---|
| >d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} | Back information, alignment and structure |
|---|
| >d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} | Back information, alignment and structure |
|---|
| >d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} | Back information, alignment and structure |
|---|
| >d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} | Back information, alignment and structure |
|---|
| >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} | Back information, alignment and structure |
|---|
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} | Back information, alignment and structure |
|---|
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|