Citrus Sinensis ID: 046926


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
DNEPLNSSIPFVAVESDVYVNSWDPTFSHVGVDINSVQSKKNAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETINLISNPKRRRKNRKAPVVGLSLGGGFLVGGVVLIIRLAGIGRKRKEGDEEDNQGFSEYIDDKFERGAGPKRFPYKELALATNDFNDDQKLGQGGFGGVYKGFLRETNS
ccccccccccEEEEEEEcccccccccccEEEEEccccccccEEEEEEEccccEEEEEEEEcccccccccEEEEEEcccccccccEEccccccccccccEEEEccccccccccccccccccccccccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHccccccEEcHHHHHHHHcccccccccccccccEEEEEEEccccc
cccccccccccEEEEEEcccccccccccEEEEEEccccccEEEEEEcccccEEEEEEEcccccccccccEEEEEccHHHHcccEEEEEEEEEEcccccEEEEEEEEEEEEEccccccccHHccccccccccccccHEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccEEEEcEcccccc
dneplnssipfvavesdvyvnswdptfshvgvdinsvqskKNAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYqvdlrlhlpefvtfgfsmatgvDFAIFSIYSWefnsslemddetinlisnpkrrrknrkapvvglslgggfLVGGVVLIIRLAGigrkrkegdeednqgFSEYiddkfergagpkrfpykelalatndfnddqklgqggfggvyKGFLRETNS
dneplnssipFVAVESDVYVNSWDPTFSHVGVDINSVQSKKNAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETINLisnpkrrrknrkapvvglslgggflvgGVVLIIRLAGigrkrkegdeednqgfseyiddkfergaGPKRFPYKELALATNdfnddqklgqggfggvykgflretns
DNEPLNSSIPFVAVESDVYVNSWDPTFSHVGVDINSVQSKKNAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETINLISNPkrrrknrkAPvvglslgggflvggvvliirlagigRKRKEGDEEDNQGFSEYIDDKFERGAGPKRFPYKELALATNDFNddqklgqggfggvykgflRETNS
********IPFVAVESDVYVNSWDPTFSHVGVDINSVQSKKNAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETINL************APVVGLSLGGGFLVGGVVLIIRLAGIG******************************FPYKELALATNDFNDDQKLGQGGFGGVYKGFL*****
*****NSSIPFVAVESDVYVNSWDPTFSHVGVDINSVQSKKNAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETINLISNPKRRRKNRKAPVVGLSLGGGFLVGGVVLIIRLAGIGRKRKEGDEEDNQG****IDDKFERGAGPKRFPYKELALATNDFNDDQKLGQGGFGGVYKGFLRE***
DNEPLNSSIPFVAVESDVYVNSWDPTFSHVGVDINSVQSKKNAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETINLISNP********APVVGLSLGGGFLVGGVVLIIRLAGIGR*********NQGFSEYIDDKFERGAGPKRFPYKELALATNDFNDDQKLGQGGFGGVYKGFLRETNS
******SSIPFVAVESDVYVNSWDPTFSHVGVDINSVQSKKNAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETINLISNPKRRRKNRKAPVVGLSLGGGFLVGGVVLIIRLAGIGRKRKEGDEEDNQGFSEYIDDKFERGAGPKRFPYKELALATNDFNDDQKLGQGGFGGVYKGFLR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DNEPLNSSIPFVAVESDVYVNSWDPTFSHVGVDINSVQSKKNAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDETINLISNPKRRRKNRKAPVVGLSLGGGFLVGGVVLIIRLAGIGRKRKEGDEEDNQGFSEYIDDKFERGAGPKRFPYKELALATNDFNDDQKLGQGGFGGVYKGFLRETNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query226 2.2.26 [Sep-21-2011]
Q9LXA5 651 L-type lectin-domain cont yes no 0.911 0.316 0.363 3e-29
Q9LSL5 675 L-type lectin-domain cont no no 0.915 0.306 0.336 4e-20
Q9M2S4 684 L-type lectin-domain cont no no 0.898 0.296 0.333 5e-15
Q9SZD5 669 L-type lectin-domain cont no no 0.898 0.303 0.306 2e-14
O04533 656 Putative L-type lectin-do no no 0.778 0.268 0.328 2e-14
P93535292 Seed lectin OS=Styphnolob N/A no 0.508 0.393 0.343 3e-13
Q39529290 Agglutinin-2 OS=Cladrasti N/A no 0.495 0.386 0.392 7e-13
Q39528293 Agglutinin-1 OS=Cladrasti N/A no 0.455 0.351 0.403 7e-13
P93538270 Bark lectin (Fragment) OS N/A no 0.455 0.381 0.366 3e-12
P81371240 Seed lectin OS=Vatairea m N/A no 0.495 0.466 0.333 7e-12
>sp|Q9LXA5|LRK91_ARATH L-type lectin-domain containing receptor kinase IX.1 OS=Arabidopsis thaliana GN=LECRK91 PE=2 SV=1 Back     alignment and function desciption
 Score =  128 bits (321), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 132/234 (56%), Gaps = 28/234 (11%)

Query: 6   NSSIPFVAVESDVYVN-SWDP--TFSHVGVDINS-VQSKKNAW-------------ISYN 48
           +S+ P V VE D + N  WDP    SHVG++ NS V S   +W             I Y+
Sbjct: 131 SSAFPLVYVEFDTFTNPEWDPLDVKSHVGINNNSLVSSNYTSWNATSHNQDIGRVLIFYD 190

Query: 49  SSTHNLSVAFT-GFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEF 107
           S+  NLSV++T    ++ +    L Y +DL   LP  VT GFS  +G       + SWEF
Sbjct: 191 SARRNLSVSWTYDLTSDPLENSSLSYIIDLSKVLPSEVTIGFSATSGGVTEGNRLLSWEF 250

Query: 108 NSSLEMDDETINLISNPKRRRKNRKAPVVGLSLGGGFLVGGVVLIIRLAGIGRKRKEGDE 167
           +SSLE+ D         K+ + ++K  ++G+S+ G F++    +   +  + RK+++   
Sbjct: 251 SSSLELID--------IKKSQNDKKGMIIGISVSG-FVLLTFFITSLIVFLKRKQQKKKA 301

Query: 168 EDNQGFSEYIDDKFERGAGPKRFPYKELALATNDFNDDQKLGQGGFGGVYKGFL 221
           E+ +  +  I++  ERGAGP++F YK+LA A N+F DD+KLG+GGFG VY+G+L
Sbjct: 302 EETENLTS-INEDLERGAGPRKFTYKDLASAANNFADDRKLGEGGFGAVYRGYL 354





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LSL5|LRK92_ARATH L-type lectin-domain containing receptor kinase IX.2 OS=Arabidopsis thaliana GN=LECRK92 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2S4|LRKS4_ARATH L-type lectin-domain containing receptor kinase S.4 OS=Arabidopsis thaliana GN=LECRKS4 PE=1 SV=1 Back     alignment and function description
>sp|Q9SZD5|LRK59_ARATH L-type lectin-domain containing receptor kinase V.9 OS=Arabidopsis thaliana GN=LECRK59 PE=2 SV=1 Back     alignment and function description
>sp|O04533|LRK52_ARATH Putative L-type lectin-domain containing receptor kinase V.2 OS=Arabidopsis thaliana GN=LECRK52 PE=3 SV=1 Back     alignment and function description
>sp|P93535|LECS_STYJP Seed lectin OS=Styphnolobium japonicum PE=2 SV=1 Back     alignment and function description
>sp|Q39529|LEC2_CLAKE Agglutinin-2 OS=Cladrastis kentukea PE=1 SV=1 Back     alignment and function description
>sp|Q39528|LEC1_CLAKE Agglutinin-1 OS=Cladrastis kentukea PE=1 SV=1 Back     alignment and function description
>sp|P93538|LECB_STYJP Bark lectin (Fragment) OS=Styphnolobium japonicum PE=2 SV=1 Back     alignment and function description
>sp|P81371|LECS_VATMA Seed lectin OS=Vatairea macrocarpa PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
356527993 709 PREDICTED: L-type lectin-domain containi 0.991 0.315 0.474 5e-54
356528003 671 PREDICTED: L-type lectin-domain containi 0.933 0.314 0.5 2e-53
356527997 709 PREDICTED: L-type lectin-domain containi 0.991 0.315 0.466 1e-52
224096774 713 predicted protein [Populus trichocarpa] 0.924 0.293 0.490 4e-51
224059892 613 predicted protein [Populus trichocarpa] 0.955 0.352 0.504 2e-50
224092745 681 predicted protein [Populus trichocarpa] 0.924 0.306 0.5 3e-50
357476157 782 Class I heat shock protein [Medicago tru 0.969 0.280 0.482 1e-49
449479044 678 PREDICTED: L-type lectin-domain containi 0.982 0.327 0.431 9e-49
449438590 665 PREDICTED: LOW QUALITY PROTEIN: L-type l 0.982 0.333 0.431 1e-48
225470605 720 PREDICTED: L-type lectin-domain containi 0.977 0.306 0.496 1e-47
>gi|356527993|ref|XP_003532590.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information
 Score =  216 bits (550), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 159/251 (63%), Gaps = 27/251 (10%)

Query: 1   DNEPLNSSIPFVAVESDVYVNSWDPTFSHVGVDINSVQSKKNA--------------WIS 46
           +++ LNS+ PFVAVE D+Y N  DP   HVG+DINS++S  N               WIS
Sbjct: 145 EDQRLNSTDPFVAVEFDIYENPDDPPGEHVGIDINSLRSVANVTWLADIKQGKLNEVWIS 204

Query: 47  YNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWE 106
           YNSS+ NLSV FTGF N++++ Q L    DLRLHLPEFVT GFS ATG+D AI S+ SW+
Sbjct: 205 YNSSSFNLSVVFTGFNNDTILRQHLSAITDLRLHLPEFVTVGFSAATGIDTAIHSVNSWD 264

Query: 107 FNSSLEMDDETIN---------LISN--PKRRRKNRKAPVVGLSLGGGFLVGGVVLIIRL 155
           F+S+L   +               SN  P +++KN+    VGLS+GG  L+GG+ LI   
Sbjct: 265 FSSTLAAQENITKGADTVARYPATSNIAPSQKKKNKTGLAVGLSIGGFVLIGGLGLIS-- 322

Query: 156 AGIGRKRKEGDEEDNQGFSEYIDDKFERGAGPKRFPYKELALATNDFNDDQKLGQGGFGG 215
            G+ +K K+G  E++  F EY+ + F RGAGP+++ Y EL  A N F D+ KLGQGGFGG
Sbjct: 323 IGLWKKWKKGSVEEDLVFEEYMGEDFGRGAGPRKYSYAELTEAANGFKDEHKLGQGGFGG 382

Query: 216 VYKGFLRETNS 226
           VYKG+L++  S
Sbjct: 383 VYKGYLKDIKS 393




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356528003|ref|XP_003532595.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information
>gi|356527997|ref|XP_003532592.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information
>gi|224096774|ref|XP_002334671.1| predicted protein [Populus trichocarpa] gi|222874064|gb|EEF11195.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224059892|ref|XP_002300009.1| predicted protein [Populus trichocarpa] gi|222847267|gb|EEE84814.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224092745|ref|XP_002334872.1| predicted protein [Populus trichocarpa] gi|222831889|gb|EEE70366.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357476157|ref|XP_003608364.1| Class I heat shock protein [Medicago truncatula] gi|355509419|gb|AES90561.1| Class I heat shock protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449479044|ref|XP_004155489.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449438590|ref|XP_004137071.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225470605|ref|XP_002262748.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
TAIR|locus:2142499 651 AT5G10530 [Arabidopsis thalian 0.389 0.135 0.368 2.8e-12
UNIPROTKB|P58907237 P58907 "Lectin alpha chain" [D 0.424 0.405 0.410 6.4e-12
UNIPROTKB|P81637237 P81637 "Lectin alpha chain" [D 0.424 0.405 0.401 8.2e-12
UNIPROTKB|P58908237 P58908 "Lectin alpha chain" [D 0.424 0.405 0.401 1e-11
UNIPROTKB|P81460237 P81460 "Concanavalin-A" [Canav 0.446 0.426 0.392 1.3e-11
UNIPROTKB|P14894290 P14894 "Concanavalin-A" [Canav 0.460 0.358 0.382 2.3e-11
UNIPROTKB|B3EWJ2237 B3EWJ2 "Lectin alpha chain" [D 0.424 0.405 0.393 2.8e-11
UNIPROTKB|P08902237 P08902 "Lectin alpha chain" [D 0.424 0.405 0.393 2.8e-11
UNIPROTKB|Q40987270 NLEC1 "Nodule lectin" [Pisum s 0.469 0.392 0.36 4.9e-11
UNIPROTKB|Q70DJ5280 Q70DJ5 "Alpha-methyl-mannoside 0.442 0.357 0.345 5.7e-11
TAIR|locus:2142499 AT5G10530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 122 (48.0 bits), Expect = 2.8e-12, Sum P(2) = 2.8e-12
 Identities = 38/103 (36%), Positives = 53/103 (51%)

Query:    28 SHVGVDINS-VQSKKNAW-------------ISYNSSTHNLSVAFT-GFRNNSVVMQGLD 72
             SHVG++ NS V S   +W             I Y+S+  NLSV++T    ++ +    L 
Sbjct:   156 SHVGINNNSLVSSNYTSWNATSHNQDIGRVLIFYDSARRNLSVSWTYDLTSDPLENSSLS 215

Query:    73 YQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDD 115
             Y +DL   LP  VT GFS  +G       + SWEF+SSLE+ D
Sbjct:   216 YIIDLSKVLPSEVTIGFSATSGGVTEGNRLLSWEFSSSLELID 258


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
UNIPROTKB|P58907 P58907 "Lectin alpha chain" [Dioclea virgata (taxid:167618)] Back     alignment and assigned GO terms
UNIPROTKB|P81637 P81637 "Lectin alpha chain" [Dioclea guianensis (taxid:99571)] Back     alignment and assigned GO terms
UNIPROTKB|P58908 P58908 "Lectin alpha chain" [Dioclea rostrata (taxid:192416)] Back     alignment and assigned GO terms
UNIPROTKB|P81460 P81460 "Concanavalin-A" [Canavalia lineata (taxid:28957)] Back     alignment and assigned GO terms
UNIPROTKB|P14894 P14894 "Concanavalin-A" [Canavalia gladiata (taxid:3824)] Back     alignment and assigned GO terms
UNIPROTKB|B3EWJ2 B3EWJ2 "Lectin alpha chain" [Dioclea sclerocarpa (taxid:1176036)] Back     alignment and assigned GO terms
UNIPROTKB|P08902 P08902 "Lectin alpha chain" [Dioclea grandiflora (taxid:3837)] Back     alignment and assigned GO terms
UNIPROTKB|Q40987 NLEC1 "Nodule lectin" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
UNIPROTKB|Q70DJ5 Q70DJ5 "Alpha-methyl-mannoside-specific lectin" [Arachis hypogaea (taxid:3818)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.17120001
hypothetical protein (713 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
cd06899236 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume 1e-28
pfam00139231 pfam00139, Lectin_legB, Legume lectin domain 6e-18
cd01951223 cd01951, lectin_L-type, legume lectins 6e-09
>gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
 Score =  107 bits (270), Expect = 1e-28
 Identities = 47/125 (37%), Positives = 59/125 (47%), Gaps = 19/125 (15%)

Query: 6   NSSIPFVAVESDVYVNSW--DPTFSHVGVDINSVQSKK-----------------NAWIS 46
           NSS   VAVE D + N    DP  +HVG+D+NS+ S K                  AWI 
Sbjct: 112 NSSNHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLVSVKAGYWDDDGGKLKSGKPMQAWID 171

Query: 47  YNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWE 106
           Y+SS+  LSV              L Y VDL   LPE V  GFS +TG+   +  I SW 
Sbjct: 172 YDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWS 231

Query: 107 FNSSL 111
           F+S+ 
Sbjct: 232 FSSNG 236


This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236

>gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain Back     alignment and domain information
>gnl|CDD|173886 cd01951, lectin_L-type, legume lectins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 226
cd06899236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 99.96
PF00139236 Lectin_legB: Legume lectin domain; InterPro: IPR00 99.95
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 99.89
KOG1187 361 consensus Serine/threonine protein kinase [Signal 98.64
cd07308218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 98.4
cd06902225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 97.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.61
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 97.3
KOG3653 534 consensus Transforming growth factor beta/activin 97.13
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 95.77
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 95.63
PF03388229 Lectin_leg-like: Legume-like lectin family; InterP 95.61
cd06903215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 95.57
cd06901248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 95.56
KOG3838 497 consensus Mannose lectin ERGIC-53, involved in gly 94.73
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 94.72
PLN03224 507 probable serine/threonine protein kinase; Provisio 94.71
PF1457575 EphA2_TM: Ephrin type-A receptor 2 transmembrane d 94.47
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 93.99
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 93.84
KOG2052 513 consensus Activin A type IB receptor, serine/threo 93.79
KOG3839351 consensus Lectin VIP36, involved in the transport 93.49
PF06697278 DUF1191: Protein of unknown function (DUF1191); In 90.96
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 90.68
PF15102146 TMEM154: TMEM154 protein family 87.65
PTZ00284 467 protein kinase; Provisional 86.96
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 86.87
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 86.6
PF15065350 NCU-G1: Lysosomal transcription factor, NCU-G1 86.48
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 85.88
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 85.68
PF03302397 VSP: Giardia variant-specific surface protein; Int 85.65
PTZ00036 440 glycogen synthase kinase; Provisional 83.01
PRK09605 535 bifunctional UGMP family protein/serine/threonine 82.39
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 81.54
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 81.52
PF12877 684 DUF3827: Domain of unknown function (DUF3827); Int 80.8
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 80.65
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
Probab=99.96  E-value=1.2e-29  Score=209.15  Aligned_cols=105  Identities=45%  Similarity=0.595  Sum_probs=97.3

Q ss_pred             CCCCCeEEEEEecccCC--CCCCCCeeEEEcCCCCccc-----------------eEEEEEcCCCcEEEEEEEeCCCCCc
Q 046926            6 NSSIPFVAVESDVYVNS--WDPTFSHVGVDINSVQSKK-----------------NAWISYNSSTHNLSVAFTGFRNNSV   66 (226)
Q Consensus         6 ~~~~~~~avefdt~~n~--~d~~~~hvgi~~n~~~s~~-----------------~~~i~y~~~~~~l~v~~~~~~~~~~   66 (226)
                      .+.+++|||||||++|.  +||++||||||+|++.|..                 +|||+||+.+++|+|+|.+....+|
T Consensus       112 ~~~~~~vAVEFDT~~n~~~~D~~~nHigIdvn~~~S~~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~  191 (236)
T cd06899         112 NSSNHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLVSVKAGYWDDDGGKLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKP  191 (236)
T ss_pred             CcccceEEEEeecccCcccCCCCCCeEEEEcCCcccceeeccccccccccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCC
Confidence            46789999999999997  3999999999999987643                 7999999999999999998877789


Q ss_pred             ccceeEEEeccccCCCcceEeeEeeecccccceeecccccccCC
Q 046926           67 VMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSS  110 (226)
Q Consensus        67 ~~~~l~~~~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~f~s~  110 (226)
                      ..|+|+..+||+.+||++|||||+|+||...+.|+|++|+|+++
T Consensus       192 ~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s~  235 (236)
T cd06899         192 KKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSN  235 (236)
T ss_pred             cCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEcC
Confidence            99999999999999999999999999999999999999999875



This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin

>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF14575 EphA2_TM: Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06697 DUF1191: Protein of unknown function (DUF1191); InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>PF15065 NCU-G1: Lysosomal transcription factor, NCU-G1 Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>PF12877 DUF3827: Domain of unknown function (DUF3827); InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
1n3o_A252 Pterocarcpus Angolensis Lectin In Complex With Alph 6e-13
1q8o_A252 Pterocartpus Angolensis Lectin Pal In Complex With 6e-13
1n47_A233 Isolectin B4 From Vicia Villosa In Complex With The 2e-12
3zvx_A261 Structure Of The Lectin From Platypodium Elegans In 6e-12
1wbl_A241 Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga 1e-11
1wbf_A242 Winged Bean Lectin, Saccharide Free Form Length = 2 1e-11
2sba_A253 Soybean Agglutinin Complexed With 2,6-Pentasacchari 2e-11
2e7q_A237 Crystal Structure Of Basic Winged Bean Lectin In Co 2e-11
3rrd_A237 Native Structure Of Dioclea Virgata Lectin Length = 3e-11
1h9w_A237 Native Dioclea Guianensis Seed Lectin Length = 237 3e-11
1h9p_A237 Crystal Structure Of Dioclea Guianensis Seed Lectin 3e-11
1qmo_E133 Structure Of Fril, A Legume Lectin That Delays Hema 4e-11
2zbj_A237 Crystal Structure Of Dioclea Rostrata Lectin Length 6e-11
2jdz_A239 Crystal Structure Of Recombinant Dioclea Guianensis 8e-11
2je7_A239 Crystal Structure Of Recombinant Dioclea Guianensis 9e-11
1fny_A237 Legume Lectin Of The Bark Of Robinia Pseudoacacia. 1e-10
2bqp_A234 The Structure Of The Pea Lectin-D-Glucopyranose Com 2e-10
2jec_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 2e-10
2gdf_A237 Crystal Structure Of Dioclea Violacea Seed Lectin L 2e-10
2je9_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 2e-10
3sh3_A237 Crystal Structure Of A Pro-Inflammatory Lectin From 2e-10
3a0k_A237 Crystal Structure Of An Antiflamatory Legume Lectin 2e-10
1lul_A253 Db58, A Legume Lectin From Dolichos Biflorus Length 3e-10
1qnw_A242 Lectin Ii From Ulex Europaeus Length = 242 3e-10
1azd_A237 Concanavalin From Canavalia Brasiliensis Length = 2 3e-10
2ow4_A237 Crystal Structure Of A Lectin From Canavalia Mariti 3e-10
2cwm_A237 Native Crystal Structure Of No Releasing Inductive 3e-10
1cn1_A237 Crystal Structure Of Demetallized Concanavalin A. T 4e-10
2cna_A237 The Covalent And Three-Dimensional Structure Of Con 4e-10
2ctv_A237 High Resolution Crystallographic Studies Of Native 4e-10
2yz4_A237 The Neutron Structure Of Concanavalin A At 2.2 Angs 5e-10
2eig_A234 Lotus Tetragonolobus Seed Lectin (Isoform) Length = 5e-10
1wuv_A237 Crystal Structure Of Native Canavalia Gladiata Lect 5e-10
3u4x_A236 Crystal Structure Of A Lectin From Camptosema Pedic 6e-10
2ovu_A237 Crystal Strucure Of A Lectin From Canavalia Gladiat 6e-10
1bjq_A253 The Dolichos Biflorus Seed Lectin In Complex With A 7e-10
3ujo_A281 Galactose-Specific Seed Lectin From Dolichos Lablab 8e-10
2pel_A236 Peanut Lectin Length = 236 8e-10
1mvq_A236 Cratylia Mollis Lectin (Isoform 1) In Complex With 8e-10
1dgl_A237 Lectin From Dioclea Grandiflora Complexed To Triman 8e-10
1bzw_A232 Peanut Lectin Complexed With C-Lactose Length = 232 1e-09
2d3p_A236 Cratylia Floribunda Seed Lectin Crystallized At Bas 1e-09
1fat_A252 Phytohemagglutinin-L Length = 252 1e-09
3usu_B242 Crystal Structure Of Butea Monosperma Seed Lectin L 4e-09
3usu_A256 Crystal Structure Of Butea Monosperma Seed Lectin L 5e-09
2fmd_A240 Structural Basis Of Carbohydrate Recognition By Bow 7e-09
1g8w_A233 Improved Structure Of Phytohemagglutinin-L From The 8e-09
1fay_A238 Winged Bean Acidic Lectin Complexed With Methyl-Alp 2e-08
1dbn_A239 Maackia Amurensis Leukoagglutinin (Lectin) With Sia 3e-08
1uzy_A242 Erythrina Crystagalli Lectin Length = 242 1e-07
1fyu_A255 Crystal Structure Of Erythrina Corallodendron Lecti 1e-07
3n35_A242 Erythrina Corallodendron Lectin Mutant (Y106g) With 2e-07
1sfy_A239 Crystal Structure Of Recombinant Erythrina Corallod 3e-07
1lte_A239 Structure Of A Legume Lectin With An Ordered N-Link 3e-07
1ax0_A239 Erythrina Corallodendron Lectin In Complex With N-A 3e-07
1gz9_A239 High-Resolution Crystal Structure Of Erythrina Cris 3e-07
1fx5_A242 Crystal Structure Analysis Of Ulex Europaeus Lectin 8e-07
3ipv_A251 Crystal Structure Of Spatholobus Parviflorus Seed L 1e-06
3ipv_B239 Crystal Structure Of Spatholobus Parviflorus Seed L 1e-06
1gsl_A243 Lectin (Fourth Isolated From (Griffonia Simplicifol 2e-06
1gnz_A257 Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)m 2e-06
1hql_A257 The Xenograft Antigen In Complex With The B4 Isolec 2e-06
>pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 Back     alignment and structure

Iteration: 1

Score = 70.9 bits (172), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 43/119 (36%), Positives = 64/119 (53%), Gaps = 25/119 (21%) Query: 12 VAVESDVYV----NSWDPTFSHVGVDINSVQSKK------------NAWISYNSSTHNLS 55 +AVE D + N+WDP + H+G+D+NS++S K N +++N ST NL Sbjct: 125 IAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLD 184 Query: 56 VAFT---GFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSL 111 V T G R + Y+VD+R LPE+V GFS A+G + ++ SW F S+L Sbjct: 185 VVATYSDGTRYE------VSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTL 237
>pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 Back     alignment and structure
>pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 Back     alignment and structure
>pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 Back     alignment and structure
>pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 Back     alignment and structure
>pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 Back     alignment and structure
>pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 Back     alignment and structure
>pdb|2E7Q|A Chain A, Crystal Structure Of Basic Winged Bean Lectin In Complex With B Blood Group Trisaccharide Length = 237 Back     alignment and structure
>pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 Back     alignment and structure
>pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|1QMO|E Chain E, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 133 Back     alignment and structure
>pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 Back     alignment and structure
>pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|1FNY|A Chain A, Legume Lectin Of The Bark Of Robinia Pseudoacacia. Length = 237 Back     alignment and structure
>pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 Back     alignment and structure
>pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 Back     alignment and structure
>pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 Back     alignment and structure
>pdb|3A0K|A Chain A, Crystal Structure Of An Antiflamatory Legume Lectin From Cymbosema Roseum Seeds Length = 237 Back     alignment and structure
>pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 Back     alignment and structure
>pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 Back     alignment and structure
>pdb|1AZD|A Chain A, Concanavalin From Canavalia Brasiliensis Length = 237 Back     alignment and structure
>pdb|2OW4|A Chain A, Crystal Structure Of A Lectin From Canavalia Maritima Seeds (Conm) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|2CWM|A Chain A, Native Crystal Structure Of No Releasing Inductive Lectin From Seeds Of The Canavalia Maritima (Conm) Length = 237 Back     alignment and structure
>pdb|1CN1|A Chain A, Crystal Structure Of Demetallized Concanavalin A. The Metal- Binding Region Length = 237 Back     alignment and structure
>pdb|2CNA|A Chain A, The Covalent And Three-Dimensional Structure Of Concanavalin A, Iv.Atomic Coordinates,Hydrogen Bonding,And Quaternary Structure Length = 237 Back     alignment and structure
>pdb|2CTV|A Chain A, High Resolution Crystallographic Studies Of Native Concanavalin A Using Rapid Laue Data Collection Methods And The Introduction Of A Monochromatic Large-Angle Oscillation Technique (Lot) Length = 237 Back     alignment and structure
>pdb|2YZ4|A Chain A, The Neutron Structure Of Concanavalin A At 2.2 Angstroms Length = 237 Back     alignment and structure
>pdb|2EIG|A Chain A, Lotus Tetragonolobus Seed Lectin (Isoform) Length = 234 Back     alignment and structure
>pdb|1WUV|A Chain A, Crystal Structure Of Native Canavalia Gladiata Lectin (Cgl): A Tetrameric Cona-Like Lectin Length = 237 Back     alignment and structure
>pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 Back     alignment and structure
>pdb|2OVU|A Chain A, Crystal Strucure Of A Lectin From Canavalia Gladiata (Cgl) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 Back     alignment and structure
>pdb|3UJO|A Chain A, Galactose-Specific Seed Lectin From Dolichos Lablab In Complex With Adenine And Galactose Length = 281 Back     alignment and structure
>pdb|2PEL|A Chain A, Peanut Lectin Length = 236 Back     alignment and structure
>pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 Back     alignment and structure
>pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 Back     alignment and structure
>pdb|1BZW|A Chain A, Peanut Lectin Complexed With C-Lactose Length = 232 Back     alignment and structure
>pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 Back     alignment and structure
>pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 Back     alignment and structure
>pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 Back     alignment and structure
>pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 Back     alignment and structure
>pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 Back     alignment and structure
>pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 Back     alignment and structure
>pdb|1FAY|A Chain A, Winged Bean Acidic Lectin Complexed With Methyl-Alpha-D-Galactose (Monoclinic Form) Length = 238 Back     alignment and structure
>pdb|1DBN|A Chain A, Maackia Amurensis Leukoagglutinin (Lectin) With Sialyllactose Length = 239 Back     alignment and structure
>pdb|1UZY|A Chain A, Erythrina Crystagalli Lectin Length = 242 Back     alignment and structure
>pdb|1FYU|A Chain A, Crystal Structure Of Erythrina Corallodendron Lectin In Hexagonal Crystal Form Length = 255 Back     alignment and structure
>pdb|3N35|A Chain A, Erythrina Corallodendron Lectin Mutant (Y106g) With N- Acetylgalactosamine Length = 242 Back     alignment and structure
>pdb|1SFY|A Chain A, Crystal Structure Of Recombinant Erythrina Corallodandron Lectin Length = 239 Back     alignment and structure
>pdb|1LTE|A Chain A, Structure Of A Legume Lectin With An Ordered N-Linked Carbohydrate In Complex With Lactose Length = 239 Back     alignment and structure
>pdb|1AX0|A Chain A, Erythrina Corallodendron Lectin In Complex With N-Actylgalactosamine Length = 239 Back     alignment and structure
>pdb|1GZ9|A Chain A, High-Resolution Crystal Structure Of Erythrina Cristagalli Lectin In Complex With 2'-Alpha-L-Fucosyllactose Length = 239 Back     alignment and structure
>pdb|1FX5|A Chain A, Crystal Structure Analysis Of Ulex Europaeus Lectin I Length = 242 Back     alignment and structure
>pdb|3IPV|A Chain A, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 251 Back     alignment and structure
>pdb|3IPV|B Chain B, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 239 Back     alignment and structure
>pdb|1GSL|A Chain A, Lectin (Fourth Isolated From (Griffonia Simplicifolia)) Complex With Y Human Blood Group Determinant Length = 243 Back     alignment and structure
>pdb|1GNZ|A Chain A, Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)metal Free Form Length = 257 Back     alignment and structure
>pdb|1HQL|A Chain A, The Xenograft Antigen In Complex With The B4 Isolectin Of Griffonia Simplicifolia Lectin-1 Length = 257 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 3e-20
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 4e-20
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 3e-19
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 3e-19
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 4e-19
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 5e-19
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 9e-19
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 2e-18
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 6e-18
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 1e-17
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 1e-17
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 2e-17
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 4e-17
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 4e-17
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 6e-17
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 6e-17
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 6e-17
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 8e-17
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 2e-16
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 1e-15
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 1e-15
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 5e-15
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 2e-14
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 6e-14
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 1e-12
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 3e-12
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 7e-12
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 5e-11
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 2e-07
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 1e-05
3soc_A 322 Activin receptor type-2A; structural genomics cons 4e-05
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 3e-04
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 Back     alignment and structure
 Score = 84.4 bits (208), Expect = 3e-20
 Identities = 46/122 (37%), Positives = 57/122 (46%), Gaps = 18/122 (14%)

Query: 6   NSSIPFVAVESDVYVNSW--DPTFSHVGVDINSVQSKK------------NAWISYNSST 51
             +  FV VE D Y NS   DP   HVG+D+NSV S K               + Y+SST
Sbjct: 112 KGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSST 171

Query: 52  HNLSVAFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVD-FAIFSIYSWEFNSS 110
             LSVA T    +      +   VDL+  LPE V FGFS +  +    I  I SW F S+
Sbjct: 172 KTLSVAVTNDNGDITT---IAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTST 228

Query: 111 LE 112
           L 
Sbjct: 229 LI 230


>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Length = 181 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 100.0
3ujo_A281 Legume lectin; carbohydrate-binding, galactose, ad 100.0
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 100.0
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 100.0
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 100.0
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 100.0
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 100.0
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 100.0
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 100.0
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 100.0
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 100.0
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 100.0
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 100.0
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 99.98
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 99.98
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 99.98
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 99.98
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 99.98
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 99.98
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 99.97
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 99.97
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 99.97
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 99.96
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 99.96
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 99.95
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 99.81
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.75
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 99.73
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 99.49
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 99.21
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 98.1
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 95.84
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 95.47
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 94.87
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 94.79
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 93.74
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 93.7
4aoj_A 329 High affinity nerve growth factor receptor; transf 92.84
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 92.47
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 91.97
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 91.12
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 90.86
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 89.77
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 89.34
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 89.33
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 88.84
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 88.06
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 87.92
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 87.79
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 87.59
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 86.07
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 85.3
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 85.1
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 85.02
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 84.92
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 84.61
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 83.73
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 83.0
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 82.8
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 82.69
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 82.36
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 82.23
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 82.06
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 80.94
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 80.89
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 80.85
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 80.83
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 80.7
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 80.36
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
Probab=100.00  E-value=1.5e-37  Score=231.25  Aligned_cols=101  Identities=43%  Similarity=0.613  Sum_probs=94.1

Q ss_pred             CCeEEEEEecccCC--CCCCCCeeEEEcCCCCccc------------eEEEEEcCCCcEEEEEEEeCCCCCcccceeEEE
Q 046926            9 IPFVAVESDVYVNS--WDPTFSHVGVDINSVQSKK------------NAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQ   74 (226)
Q Consensus         9 ~~~~avefdt~~n~--~d~~~~hvgi~~n~~~s~~------------~~~i~y~~~~~~l~v~~~~~~~~~~~~~~l~~~   74 (226)
                      ||+|||||||++|.  |||++||||||+||+.|.+            +|||+||+.+++|+|+|++.+. +  .|+|+..
T Consensus         1 n~~vAVEFDT~~N~e~~Dp~~nHVGIdvNsi~S~~s~~~~l~sG~~~~v~I~Yd~~~~~L~V~l~~~~~-~--~p~ls~~   77 (133)
T 1qmo_E            1 SNVVAVEFDTYLNPDYGDPNYIHIGIDVNSIRSKVTAKWDWQNGKIATAHISYNSVSKRLSVTSYYAGS-K--PATLSYD   77 (133)
T ss_dssp             CCCEEEEEECSCCGGGTCCSSCEEEEEESSSSCSEEEECCCCTTSCEEEEEEEETTTTEEEEEEECSSS-C--CEEEEEE
T ss_pred             CCEEEEEEeCCcCccccCCCCCeeEEecccccccceeeeEEcCCCEEEEEEEEeCCCcEEEEEEccCCC-c--cceEEEe
Confidence            68999999999997  9999999999999998765            8999999999999999998764 3  7999999


Q ss_pred             eccccCCCcceEeeEeeecccccceeecccccccCCCc
Q 046926           75 VDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLE  112 (226)
Q Consensus        75 ~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~f~s~~~  112 (226)
                      +||+.+||++|||||+|+||...+.|+|++|+|++.+.
T Consensus        78 vdLs~~l~e~v~VGFSAsTG~~~~~h~IlsWsF~s~l~  115 (133)
T 1qmo_E           78 IELHTVLPEWVRVGLSASTGQDKERNTVHSWSFTSSLW  115 (133)
T ss_dssp             CCGGGTSCSEEEEEEEEECSSSCCEEEEEEEEEEEEEE
T ss_pred             echHHhccccEEEEEEeccCCCcceeEEEEEEEEeeCC
Confidence            99999999999999999999999999999999998764



>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 226
d1nlsa_237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 1e-22
d2d3sa1237 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso 1e-21
d1f9ka_234 b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca 5e-21
g1qmo.1230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 2e-20
d1gzca_239 b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( 2e-20
d1qnwa_237 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 2e-20
d1g9fa_251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 4e-20
d1n47a_233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 6e-20
d1v6ia_232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 9e-20
d1ukga_241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 1e-19
d1fx5a_240 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 2e-19
d1hqla_236 b.29.1.1 (A:) Legume lectin {Griffonia simplicifol 3e-19
d1g7ya_253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 9e-19
d1g8wa_233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 2e-18
d1leda_243 b.29.1.1 (A:) Legume lectin {West-central african 4e-17
d1fnya_237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 1e-16
d1ioaa_228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 5e-16
d1avba_226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 1e-15
d1dbna_239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 4e-15
g2ltn.1229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 6e-15
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 3e-12
d1gv9a_228 b.29.1.13 (A:) Carbohydrate-recognition domain of 3e-09
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-06
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-06
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 9e-06
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 5e-05
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 7e-05
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 5e-04
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 7e-04
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 7e-04
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 7e-04
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 8e-04
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 8e-04
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 0.001
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 0.001
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 0.002
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 0.002
d2a6va1218 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Bake 0.003
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 0.003
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 0.003
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 0.003
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 0.004
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 0.004
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 0.004
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 0.004
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Concanavalin A
species: Jack bean (Canavalia ensiformis) [TaxId: 3823]
 Score = 90.0 bits (223), Expect = 1e-22
 Identities = 44/127 (34%), Positives = 60/127 (47%), Gaps = 17/127 (13%)

Query: 11  FVAVESDVYVNS--WDPTFSHVGVDINSVQSKK------------NAWISYNSSTHNLSV 56
            VAVE D Y N+   DP++ H+G+DI SV+SKK             A I YNS    LS 
Sbjct: 4   IVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTAHIIYNSVDKRLSA 63

Query: 57  AFTGFRNNSVVMQGLDYQVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMDDE 116
             +    +S     + Y VDL   LPE+V  G S +TG+     +I SW F S L+ +  
Sbjct: 64  VVSYPNADSAT---VSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKSNST 120

Query: 117 TINLISN 123
                 +
Sbjct: 121 HETNALH 127


>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
d1nlsa_237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 99.97
d1hqla_236 Legume lectin {Griffonia simplicifolia, lectin I-b 99.97
d1leda_243 Legume lectin {West-central african legume (Griffo 99.97
d2d3sa1237 Legume lectin {Winged bean (Psophocarpus tetragono 99.97
d1fx5a_240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 99.96
d1qnwa_237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 99.96
d1gzca_239 Legume lectin {Cockspur coral tree (Erythrina cris 99.96
d1f9ka_234 Legume lectin {Winged bean (Psophocarpus tetragono 99.96
d1g9fa_251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 99.96
d1g7ya_253 Legume lectin {Horse gram (Dolichos biflorus), dif 99.95
d1n47a_233 Legume lectin {Hairy vetch (Vicia villosa), isolec 99.95
d1ukga_241 Legume lectin {Bloodwood tree (Pterocarpus angolen 99.95
d1g8wa_233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.95
d1fnya_237 Legume lectin {Black locust (Robinia pseudoacacia) 99.94
d1v6ia_232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 99.94
g1qmo.1230 Legume lectin {Field bean (Dolichos lablab), Fril 99.94
d1dbna_239 Legume lectin {Maackia amurensis, leukoagglutinin 99.94
d1ioaa_228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.9
g2ltn.1229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 99.89
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.86
d1avba_226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.86
d1gv9a_228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 99.41
d2a6va1218 Emp46p N-terminal domain {Baker's yeast (Saccharom 98.36
d2a6za1221 Emp47p N-terminal domain {Baker's yeast (Saccharom 98.11
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 91.41
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 86.44
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 86.36
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Concanavalin A
species: Jack bean (Canavalia ensiformis) [TaxId: 3823]
Probab=99.97  E-value=4.8e-32  Score=218.94  Aligned_cols=104  Identities=41%  Similarity=0.603  Sum_probs=95.8

Q ss_pred             CCCeEEEEEecccCC--CCCCCCeeEEEcCCCCccc------------eEEEEEcCCCcEEEEEEEeCCCCCcccceeEE
Q 046926            8 SIPFVAVESDVYVNS--WDPTFSHVGVDINSVQSKK------------NAWISYNSSTHNLSVAFTGFRNNSVVMQGLDY   73 (226)
Q Consensus         8 ~~~~~avefdt~~n~--~d~~~~hvgi~~n~~~s~~------------~~~i~y~~~~~~l~v~~~~~~~~~~~~~~l~~   73 (226)
                      .|++|||||||++|.  |||++||||||+|++.|..            +|||+||+.+++|.|++.+.   ++..|+|++
T Consensus         1 an~ivAVEFDT~~N~~~~Dp~~nHIgIdvns~~S~~~~~~~l~~G~~~~v~I~Yd~~~~~L~V~~~~~---~~~~~~ls~   77 (237)
T d1nlsa_           1 ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTAHIIYNSVDKRLSAVVSYP---NADSATVSY   77 (237)
T ss_dssp             CCCEEEEEEECSCCGGGTCCSSCEEEEEESSSSCSEEEECCCCTTCEEEEEEEEETTTTEEEEEEECT---TSCCEEEEE
T ss_pred             CCCEEEEEEECCcCCCCCCCCCCEEEEEeCCCCccceecccccCCCEEEEEEEEecCCcEEEEEEecC---CCCCeEEEE
Confidence            489999999999996  8999999999999998854            89999999999999999763   567889999


Q ss_pred             EeccccCCCcceEeeEeeecccccceeecccccccCCCccc
Q 046926           74 QVDLRLHLPEFVTFGFSMATGVDFAIFSIYSWEFNSSLEMD  114 (226)
Q Consensus        74 ~~~Ls~~l~~~v~vGFsastg~~~~~~~il~W~f~s~~~~~  114 (226)
                      .+||+.+|+++||+||+|+||...+.|+|++|+|++++...
T Consensus        78 ~vdL~~~l~~~vyvGFSAsTG~~~~~h~I~sWsFsS~~~~~  118 (237)
T d1nlsa_          78 DVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKSN  118 (237)
T ss_dssp             ECCGGGTSCSEEEEEEEEECSSSCCCCEEEEEEEEEEEEES
T ss_pred             EEChHHhCCCcEEEEEEeecCCCccceEEEEEEEEeecccc
Confidence            99999999999999999999999999999999999876544



>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure