Citrus Sinensis ID: 046976

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MGSSLLLPATSVTGVKWSRVQVKGPRFHVRASLDTNVSDMSVNAPKGLFLPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDHGHEVLLI
cccccccccccccccccccCECcccEEEEECcccccccccccccccccccccccccccccCEEEEEccccccHHHHHHHHHcccEEEcc
*********************VKGPRFHVRASLDTNV****VNAPKGLFLPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDHGHEVLLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSSLLLPATSVTGVKWSRVQVKGPRFHVRASLDTNVSDMSVNAPKGLFLPEPEHYRGPKLKVAIIGAGLAGMSTAVELLDHGHEVLLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zeta-carotene desaturase, chloroplastic/chromoplastic Catalyzes the conversion of zeta-carotene to lycopene via the intermediary of neurosporene. It carries out two consecutive desaturations (introduction of double bonds) at positions C-7 and C-7'.probableQ9ZTP4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VDC, chain G
Confidence level:very confident
Coverage over the Query: 6-89
View the alignment between query and template
View the model in PyMOL