Citrus Sinensis ID: 046976
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 89 | ||||||
| 13991921 | 570 | zeta-carotene desaturase precursor [Citr | 0.966 | 0.150 | 0.895 | 5e-37 | |
| 15824043 | 570 | zeta-carotene desaturase [Citrus unshiu] | 0.966 | 0.150 | 0.883 | 7e-37 | |
| 18073986 | 570 | zeta-carotene desaturase [Citrus sinensi | 0.966 | 0.150 | 0.883 | 5e-36 | |
| 83637848 | 570 | zeta-carotene desaturase [Citrus unshiu] | 0.966 | 0.150 | 0.872 | 8e-36 | |
| 190576747 | 570 | zeta carotene desaturase [Citrus maxima] | 0.966 | 0.150 | 0.872 | 1e-35 | |
| 50365500 | 263 | zeta-carotene desaturase [Citrus clement | 0.966 | 0.326 | 0.860 | 2e-34 | |
| 226295512 | 572 | zeta-carotene desaturase [Carica papaya] | 0.966 | 0.150 | 0.752 | 2e-28 | |
| 225624819 | 552 | zeta-carotene desaturase protein [Carica | 0.966 | 0.155 | 0.741 | 3e-28 | |
| 298204896 | 552 | unnamed protein product [Vitis vinifera] | 0.741 | 0.119 | 0.863 | 6e-26 | |
| 359487812 | 583 | PREDICTED: zeta-carotene desaturase, chl | 0.966 | 0.147 | 0.66 | 6e-26 |
| >gi|13991921|gb|AAK51557.1|AF372617_1 zeta-carotene desaturase precursor [Citrus x paradisi] | Back alignment and taxonomy information |
|---|
Score = 157 bits (398), Expect = 5e-37, Method: Compositional matrix adjust.
Identities = 77/86 (89%), Positives = 78/86 (90%)
Query: 1 MGSSLLLPATSVTGVKWSRVQVKGPRFHVRASLDTNVSDMSVNAPKGLFLPEPEHYRGPK 60
MGSS+L PATSVTGV WSRVQ K PRF VRASLD NVSDMSVNAPKGLF PEPEHYRGPK
Sbjct: 1 MGSSVLFPATSVTGVSWSRVQEKCPRFCVRASLDANVSDMSVNAPKGLFPPEPEHYRGPK 60
Query: 61 LKVAIIGAGLAGMSTAVELLDHGHEV 86
LKVAIIGAGLAGMSTAVELLD GHEV
Sbjct: 61 LKVAIIGAGLAGMSTAVELLDQGHEV 86
|
Source: Citrus x paradisi Species: Citrus x paradisi Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|15824043|dbj|BAB68552.1| zeta-carotene desaturase [Citrus unshiu] | Back alignment and taxonomy information |
|---|
| >gi|18073986|emb|CAC85667.1| zeta-carotene desaturase [Citrus sinensis] | Back alignment and taxonomy information |
|---|
| >gi|83637848|gb|ABC33728.1| zeta-carotene desaturase [Citrus unshiu] | Back alignment and taxonomy information |
|---|
| >gi|190576747|gb|ACE79169.1| zeta carotene desaturase [Citrus maxima] | Back alignment and taxonomy information |
|---|
| >gi|50365500|gb|AAT76050.1| zeta-carotene desaturase [Citrus clementina] | Back alignment and taxonomy information |
|---|
| >gi|226295512|gb|ACO40527.1| zeta-carotene desaturase [Carica papaya] | Back alignment and taxonomy information |
|---|
| >gi|225624819|gb|ABG72806.2| zeta-carotene desaturase protein [Carica papaya] | Back alignment and taxonomy information |
|---|
| >gi|298204896|emb|CBI34203.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359487812|ref|XP_002277348.2| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 89 | ||||||
| TAIR|locus:2114789 | 558 | ZDS "zeta-carotene desaturase" | 0.921 | 0.146 | 0.674 | 1.7e-22 | |
| TAIR|locus:2129515 | 566 | PDS3 "phytoene desaturase 3" [ | 0.977 | 0.153 | 0.351 | 0.00019 |
| TAIR|locus:2114789 ZDS "zeta-carotene desaturase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 268 (99.4 bits), Expect = 1.7e-22, P = 1.7e-22
Identities = 58/86 (67%), Positives = 66/86 (76%)
Query: 1 MGSSLLLPATSVTGVKWSRVQVKGPRFHVRASLDTNVSDMSVNAPKGLFLPEPEHYRGPK 60
M SS++ AT V +K RF+V +SLD++VSDMSVNAPKGLF PEP Y+GPK
Sbjct: 1 MASSVVFAATGSLSVP----PLKSRRFYVNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPK 56
Query: 61 LKVAIIGAGLAGMSTAVELLDHGHEV 86
LKVAIIGAGLAGMSTAVELLD GHEV
Sbjct: 57 LKVAIIGAGLAGMSTAVELLDQGHEV 82
|
|
| TAIR|locus:2129515 PDS3 "phytoene desaturase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00031131001 | SubName- Full=Chromosome chr14 scaffold_54, whole genome shotgun sequence; (583 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00027139001 | • | • | • | 0.980 | |||||||
| GSVIVG00016526001 | • | • | • | 0.939 | |||||||
| GSVIVG00025310001 | • | • | • | 0.938 | |||||||
| PDS1 | • | • | • | • | 0.917 | ||||||
| GSVIVG00025926001 | • | • | 0.903 | ||||||||
| GSVIVG00033552001 | • | • | • | 0.611 | |||||||
| GSVIVG00018857001 | • | • | • | • | • | 0.537 | |||||
| GSVIVG00024765001 | • | • | • | • | 0.524 | ||||||
| GSVIVG00028499001 | • | • | • | 0.506 | |||||||
| GSVIVG00016085001 | • | • | 0.505 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 89 | |||
| PLN02487 | 569 | PLN02487, PLN02487, zeta-carotene desaturase | 2e-34 | |
| TIGR02732 | 474 | TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot | 2e-09 | |
| pfam01266 | 234 | pfam01266, DAO, FAD dependent oxidoreductase | 1e-06 | |
| COG3349 | 485 | COG3349, COG3349, Uncharacterized conserved protei | 3e-06 | |
| COG0665 | 387 | COG0665, DadA, Glycine/D-amino acid oxidases (deam | 7e-06 | |
| PRK12814 | 652 | PRK12814, PRK12814, putative NADPH-dependent gluta | 7e-06 | |
| pfam07992 | 283 | pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp | 8e-06 | |
| PRK07233 | 434 | PRK07233, PRK07233, hypothetical protein; Provisio | 9e-06 | |
| pfam13450 | 66 | pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- | 1e-05 | |
| PLN02612 | 567 | PLN02612, PLN02612, phytoene desaturase | 1e-05 | |
| COG0654 | 387 | COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox | 2e-05 | |
| pfam00890 | 401 | pfam00890, FAD_binding_2, FAD binding domain | 3e-05 | |
| COG1231 | 450 | COG1231, COG1231, Monoamine oxidase [Amino acid tr | 7e-05 | |
| PRK11749 | 457 | PRK11749, PRK11749, dihydropyrimidine dehydrogenas | 7e-05 | |
| PRK05329 | 422 | PRK05329, PRK05329, anaerobic glycerol-3-phosphate | 8e-05 | |
| TIGR01316 | 449 | TIGR01316, gltA, glutamate synthase (NADPH), homot | 1e-04 | |
| PRK09853 | 1019 | PRK09853, PRK09853, putative selenate reductase su | 2e-04 | |
| COG2081 | 408 | COG2081, COG2081, Predicted flavoproteins [General | 2e-04 | |
| pfam03486 | 405 | pfam03486, HI0933_like, HI0933-like protein | 2e-04 | |
| PRK07208 | 479 | PRK07208, PRK07208, hypothetical protein; Provisio | 3e-04 | |
| PRK12771 | 564 | PRK12771, PRK12771, putative glutamate synthase (N | 3e-04 | |
| pfam01494 | 349 | pfam01494, FAD_binding_3, FAD binding domain | 4e-04 | |
| TIGR03026 | 409 | TIGR03026, NDP-sugDHase, nucleotide sugar dehydrog | 4e-04 | |
| COG1233 | 487 | COG1233, COG1233, Phytoene dehydrogenase and relat | 4e-04 | |
| PRK12810 | 471 | PRK12810, gltD, glutamate synthase subunit beta; R | 4e-04 | |
| COG0493 | 457 | COG0493, GltD, NADPH-dependent glutamate synthase | 5e-04 | |
| PRK06753 | 373 | PRK06753, PRK06753, hypothetical protein; Provisio | 6e-04 | |
| COG1053 | 562 | COG1053, SdhA, Succinate dehydrogenase/fumarate re | 9e-04 | |
| PRK12834 | 549 | PRK12834, PRK12834, putative FAD-binding dehydroge | 9e-04 | |
| COG0569 | 225 | COG0569, TrkA, K+ transport systems, NAD-binding c | 0.001 | |
| PRK12770 | 352 | PRK12770, PRK12770, putative glutamate synthase su | 0.001 | |
| PRK06292 | 460 | PRK06292, PRK06292, dihydrolipoamide dehydrogenase | 0.001 | |
| PRK01747 | 662 | PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)- | 0.001 | |
| COG1004 | 414 | COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenas | 0.002 | |
| PRK12409 | 410 | PRK12409, PRK12409, D-amino acid dehydrogenase sma | 0.002 | |
| PLN02712 | 667 | PLN02712, PLN02712, arogenate dehydrogenase | 0.002 | |
| PRK06847 | 375 | PRK06847, PRK06847, hypothetical protein; Provisio | 0.002 | |
| COG0446 | 415 | COG0446, HcaD, Uncharacterized NAD(FAD)-dependent | 0.003 | |
| PRK08132 | 547 | PRK08132, PRK08132, FAD-dependent oxidoreductase; | 0.003 | |
| pfam03721 | 188 | pfam03721, UDPG_MGDP_dh_N, UDP-glucose/GDP-mannose | 0.003 | |
| TIGR02731 | 453 | TIGR02731, phytoene_desat, phytoene desaturase | 0.004 | |
| PRK07588 | 391 | PRK07588, PRK07588, hypothetical protein; Provisio | 0.004 | |
| COG3075 | 421 | COG3075, GlpB, Anaerobic glycerol-3-phosphate dehy | 0.004 |
| >gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase | Back alignment and domain information |
|---|
Score = 122 bits (309), Expect = 2e-34
Identities = 55/77 (71%), Positives = 59/77 (76%)
Query: 10 TSVTGVKWSRVQVKGPRFHVRASLDTNVSDMSVNAPKGLFLPEPEHYRGPKLKVAIIGAG 69
S R +K R V +SLD+NVSDMSVNAPKGLF PEPE Y+GPKLKVAIIGAG
Sbjct: 25 RSPVAGAVLRSPLKSARLSVSSSLDSNVSDMSVNAPKGLFPPEPEAYKGPKLKVAIIGAG 84
Query: 70 LAGMSTAVELLDHGHEV 86
LAGMSTAVELLD GHEV
Sbjct: 85 LAGMSTAVELLDQGHEV 101
|
Length = 569 |
| >gnl|CDD|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|234094 TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223643 COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234978 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223936 COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|237093 PRK12409, PRK12409, D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215382 PLN02712, PLN02712, arogenate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236158 PRK08132, PRK08132, FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217692 pfam03721, UDPG_MGDP_dh_N, UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|169028 PRK07588, PRK07588, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225617 COG3075, GlpB, Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 89 | |||
| PRK12831 | 464 | putative oxidoreductase; Provisional | 99.72 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 99.72 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 99.7 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 99.68 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 99.67 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 99.66 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 99.66 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 99.65 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 99.65 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 99.64 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 99.64 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 99.63 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 99.62 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 99.62 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 99.6 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 99.57 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 99.57 | |
| COG0493 | 457 | GltD NADPH-dependent glutamate synthase beta chain | 99.5 | |
| KOG0399 | 2142 | consensus Glutamate synthase [Amino acid transport | 99.43 | |
| PLN02487 | 569 | zeta-carotene desaturase | 98.78 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 98.61 | |
| COG1635 | 262 | THI4 Ribulose 1,5-bisphosphate synthetase, convert | 98.56 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.54 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 98.5 | |
| PF01946 | 230 | Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. | 98.5 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 98.49 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 98.45 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 98.43 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 98.43 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 98.43 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 98.42 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 98.41 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.41 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 98.39 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 98.39 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 98.39 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 98.38 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.38 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.37 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 98.37 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 98.37 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 98.37 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 98.37 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.37 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 98.37 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 98.36 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 98.36 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 98.36 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 98.35 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 98.34 | |
| PLN02985 | 514 | squalene monooxygenase | 98.33 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 98.33 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 98.33 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 98.33 | |
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 98.33 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 98.32 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 98.31 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.31 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 98.31 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 98.3 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 98.3 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 98.3 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 98.29 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 98.29 | |
| PRK06116 | 450 | glutathione reductase; Validated | 98.29 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 98.29 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 98.29 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 98.28 | |
| PRK05868 | 372 | hypothetical protein; Validated | 98.28 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 98.27 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 98.27 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 98.25 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 98.25 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 98.25 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 98.24 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 98.24 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 98.24 | |
| PLN02463 | 447 | lycopene beta cyclase | 98.23 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 98.22 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 98.22 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 98.22 | |
| PRK06370 | 463 | mercuric reductase; Validated | 98.22 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 98.22 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 98.21 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 98.21 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 98.21 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 98.18 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 98.18 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 98.17 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 98.16 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 98.14 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 98.14 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 98.13 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 98.12 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 98.12 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 98.12 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 98.11 | |
| PTZ00188 | 506 | adrenodoxin reductase; Provisional | 98.1 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 98.1 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 98.1 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 98.09 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 98.08 | |
| PRK05192 | 618 | tRNA uridine 5-carboxymethylaminomethyl modificati | 98.07 | |
| PTZ00367 | 567 | squalene epoxidase; Provisional | 98.07 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 98.07 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 98.06 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 98.06 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 98.05 | |
| KOG1399 | 448 | consensus Flavin-containing monooxygenase [Seconda | 98.05 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 98.05 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 98.04 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 98.02 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 98.02 | |
| PRK08401 | 466 | L-aspartate oxidase; Provisional | 98.01 | |
| PRK07121 | 492 | hypothetical protein; Validated | 98.0 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 98.0 | |
| KOG2614 | 420 | consensus Kynurenine 3-monooxygenase and related f | 97.98 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 97.97 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 97.97 | |
| PLN02507 | 499 | glutathione reductase | 97.95 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 97.95 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 97.94 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 97.94 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 97.93 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 97.93 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 97.93 | |
| PRK08641 | 589 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.91 | |
| PLN02612 | 567 | phytoene desaturase | 97.91 | |
| PRK06481 | 506 | fumarate reductase flavoprotein subunit; Validated | 97.9 | |
| PRK07573 | 640 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.89 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 97.89 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 97.88 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 97.88 | |
| PLN02661 | 357 | Putative thiazole synthesis | 97.87 | |
| PRK12842 | 574 | putative succinate dehydrogenase; Reviewed | 97.86 | |
| PLN02546 | 558 | glutathione reductase | 97.86 | |
| PRK07803 | 626 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.83 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 97.83 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 97.83 | |
| PRK12834 | 549 | putative FAD-binding dehydrogenase; Reviewed | 97.82 | |
| PRK07057 | 591 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.81 | |
| PRK12837 | 513 | 3-ketosteroid-delta-1-dehydrogenase; Provisional | 97.81 | |
| PLN02568 | 539 | polyamine oxidase | 97.8 | |
| PRK09078 | 598 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.79 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 97.78 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.77 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 97.77 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 97.76 | |
| PRK08958 | 588 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.76 | |
| PTZ00139 | 617 | Succinate dehydrogenase [ubiquinone] flavoprotein | 97.76 | |
| PLN00128 | 635 | Succinate dehydrogenase [ubiquinone] flavoprotein | 97.76 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 97.76 | |
| PRK08626 | 657 | fumarate reductase flavoprotein subunit; Provision | 97.75 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 97.75 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 97.74 | |
| PLN02676 | 487 | polyamine oxidase | 97.73 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 97.73 | |
| PRK12835 | 584 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 97.73 | |
| PRK06854 | 608 | adenylylsulfate reductase subunit alpha; Validated | 97.72 | |
| PRK06069 | 577 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.71 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 97.68 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 97.68 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 97.68 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 97.67 | |
| PRK12844 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 97.67 | |
| PRK05945 | 575 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.65 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 97.63 | |
| PRK08275 | 554 | putative oxidoreductase; Provisional | 97.62 | |
| PRK07843 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 97.61 | |
| PRK02106 | 560 | choline dehydrogenase; Validated | 97.58 | |
| PRK06263 | 543 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.57 | |
| PLN02815 | 594 | L-aspartate oxidase | 97.57 | |
| PF14691 | 111 | Fer4_20: Dihydroprymidine dehydrogenase domain II, | 97.57 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 97.54 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 97.54 | |
| PRK06134 | 581 | putative FAD-binding dehydrogenase; Reviewed | 97.52 | |
| PRK08071 | 510 | L-aspartate oxidase; Provisional | 97.51 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 97.51 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 97.51 | |
| PLN03000 | 881 | amine oxidase | 97.49 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 97.49 | |
| COG3075 | 421 | GlpB Anaerobic glycerol-3-phosphate dehydrogenase | 97.49 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 97.48 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 97.47 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 97.47 | |
| PRK12843 | 578 | putative FAD-binding dehydrogenase; Reviewed | 97.47 | |
| COG1053 | 562 | SdhA Succinate dehydrogenase/fumarate reductase, f | 97.46 | |
| PRK12839 | 572 | hypothetical protein; Provisional | 97.46 | |
| PRK07395 | 553 | L-aspartate oxidase; Provisional | 97.46 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 97.43 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 97.42 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 97.41 | |
| PRK08205 | 583 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.41 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 97.4 | |
| PRK09077 | 536 | L-aspartate oxidase; Provisional | 97.37 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 97.36 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 97.36 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 97.34 | |
| PRK12845 | 564 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 97.31 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 97.31 | |
| PLN02976 | 1713 | amine oxidase | 97.26 | |
| COG3573 | 552 | Predicted oxidoreductase [General function predict | 97.21 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 97.2 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 97.19 | |
| COG0445 | 621 | GidA Flavin-dependent tRNA uridine 5-carboxymethyl | 97.19 | |
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 97.18 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 97.15 | |
| PRK07512 | 513 | L-aspartate oxidase; Provisional | 97.11 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 97.07 | |
| KOG1298 | 509 | consensus Squalene monooxygenase [Lipid transport | 97.05 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 97.02 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 96.99 | |
| COG0029 | 518 | NadB Aspartate oxidase [Coenzyme metabolism] | 96.99 | |
| COG0578 | 532 | GlpA Glycerol-3-phosphate dehydrogenase [Energy pr | 96.99 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 96.98 | |
| COG1206 | 439 | Gid NAD(FAD)-utilizing enzyme possibly involved in | 96.97 | |
| COG2303 | 542 | BetA Choline dehydrogenase and related flavoprotei | 96.95 | |
| COG0562 | 374 | Glf UDP-galactopyranose mutase [Cell envelope biog | 96.94 | |
| KOG1800 | 468 | consensus Ferredoxin/adrenodoxin reductase [Nucleo | 96.89 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 96.82 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 96.76 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 96.76 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 96.76 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 96.74 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 96.74 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 96.71 | |
| KOG0404 | 322 | consensus Thioredoxin reductase [Posttranslational | 96.68 | |
| KOG2415 | 621 | consensus Electron transfer flavoprotein ubiquinon | 96.66 | |
| PLN02785 | 587 | Protein HOTHEAD | 96.64 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 96.59 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 96.57 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 96.56 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 96.52 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 96.5 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 96.49 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 96.48 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 96.47 | |
| PRK06370 | 463 | mercuric reductase; Validated | 96.47 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 96.46 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 96.45 | |
| KOG2311 | 679 | consensus NAD/FAD-utilizing protein possibly invol | 96.45 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 96.45 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 96.45 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 96.45 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 96.44 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 96.43 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 96.43 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 96.41 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 96.4 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.38 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 96.36 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.33 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 96.33 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 96.31 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 96.3 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 96.29 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 96.28 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 96.28 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 96.28 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 96.27 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 96.26 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 96.26 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 96.24 | |
| KOG2852 | 380 | consensus Possible oxidoreductase [General functio | 96.22 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 96.22 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 96.18 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 96.18 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 96.17 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 96.16 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.15 | |
| PRK06116 | 450 | glutathione reductase; Validated | 96.13 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 96.1 | |
| KOG4716 | 503 | consensus Thioredoxin reductase [Posttranslational | 96.1 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.09 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 96.07 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 96.05 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.05 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 96.04 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 96.04 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 96.02 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 96.0 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.0 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 95.96 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.95 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 95.94 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.92 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.91 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.91 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 95.89 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 95.89 | |
| PLN02507 | 499 | glutathione reductase | 95.84 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 95.83 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 95.82 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 95.76 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 95.75 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 95.73 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.72 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 95.71 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 95.67 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.62 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 95.62 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.6 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 95.54 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 95.53 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 95.53 | |
| PLN02546 | 558 | glutathione reductase | 95.42 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 95.38 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 95.37 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 95.37 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 95.35 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 95.32 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 95.31 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 95.31 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 95.29 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 95.29 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 95.28 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 95.23 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 95.22 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 95.15 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.12 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 95.1 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 95.04 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 95.02 | |
| PRK01390 | 460 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.01 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 94.98 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 94.98 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 94.95 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 94.87 | |
| PRK01368 | 454 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.85 | |
| PF06100 | 500 | Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross | 94.84 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 94.79 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 94.77 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 94.77 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 94.75 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 94.73 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 94.72 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 94.65 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 94.62 | |
| KOG2665 | 453 | consensus Predicted FAD-dependent oxidoreductase [ | 94.61 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 94.58 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 94.56 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 94.56 | |
| PRK03806 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.54 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 94.52 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 94.5 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 94.5 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 94.5 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 94.45 | |
| KOG3923 | 342 | consensus D-aspartate oxidase [Amino acid transpor | 94.4 | |
| PRK03803 | 448 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.38 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 94.34 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 94.33 | |
| COG4529 | 474 | Uncharacterized protein conserved in bacteria [Fun | 94.32 | |
| KOG2844 | 856 | consensus Dimethylglycine dehydrogenase precursor | 94.3 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 94.29 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 94.29 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 94.28 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 94.24 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 94.24 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 94.21 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 94.18 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 94.17 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 94.16 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 94.15 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 94.15 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 94.13 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 94.12 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 94.07 | |
| KOG2404 | 477 | consensus Fumarate reductase, flavoprotein subunit | 94.05 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 94.04 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 94.03 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 93.99 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 93.95 | |
| PRK00683 | 418 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.95 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 93.95 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 93.91 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 93.88 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 93.88 | |
| PF07991 | 165 | IlvN: Acetohydroxy acid isomeroreductase, catalyti | 93.88 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 93.86 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 93.85 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 93.84 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 93.83 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 93.76 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 93.75 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 93.74 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 93.66 | |
| KOG2853 | 509 | consensus Possible oxidoreductase [General functio | 93.63 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 93.58 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 93.58 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 93.54 | |
| PLN02494 | 477 | adenosylhomocysteinase | 93.53 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 93.49 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 93.47 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 93.46 | |
| TIGR02964 | 246 | xanthine_xdhC xanthine dehydrogenase accessory pro | 93.44 | |
| KOG3855 | 481 | consensus Monooxygenase involved in coenzyme Q (ub | 93.44 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 93.41 | |
| KOG2960 | 328 | consensus Protein involved in thiamine biosynthesi | 93.37 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 93.34 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 93.33 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 93.32 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 93.31 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 93.3 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 93.29 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 93.26 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 93.26 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 93.23 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 93.23 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 93.22 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 93.2 | |
| PRK09288 | 395 | purT phosphoribosylglycinamide formyltransferase 2 | 93.14 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 93.09 | |
| COG0240 | 329 | GpsA Glycerol-3-phosphate dehydrogenase [Energy pr | 93.08 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.07 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 93.07 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 93.01 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 93.0 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 92.99 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 92.97 | |
| PRK14573 | 809 | bifunctional D-alanyl-alanine synthetase A/UDP-N-a | 92.97 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.95 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 92.93 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.92 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 92.87 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 92.85 | |
| PLN02712 | 667 | arogenate dehydrogenase | 92.85 | |
| PTZ00345 | 365 | glycerol-3-phosphate dehydrogenase; Provisional | 92.84 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 92.82 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 92.8 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 92.79 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 92.75 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 92.73 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.72 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 92.69 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 92.69 | |
| PRK08223 | 287 | hypothetical protein; Validated | 92.66 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 92.65 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 92.64 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 92.62 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 92.57 | |
| PRK12439 | 341 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 92.55 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 92.52 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 92.5 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 92.49 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 92.4 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 92.4 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 92.39 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 92.32 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 92.3 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 92.26 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 92.24 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 92.23 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 92.13 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 92.12 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 92.11 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 92.06 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 92.05 | |
| PF00289 | 110 | CPSase_L_chain: Carbamoyl-phosphate synthase L cha | 92.03 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 92.02 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 92.0 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 91.99 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 91.98 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 91.98 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 91.95 | |
| KOG1238 | 623 | consensus Glucose dehydrogenase/choline dehydrogen | 91.95 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 91.91 | |
| COG0677 | 436 | WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas | 91.91 | |
| PRK06849 | 389 | hypothetical protein; Provisional | 91.9 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 91.88 | |
| PF00996 | 438 | GDI: GDP dissociation inhibitor; InterPro: IPR0182 | 91.85 | |
| PLN02256 | 304 | arogenate dehydrogenase | 91.81 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 91.79 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 91.78 | |
| PRK15182 | 425 | Vi polysaccharide biosynthesis protein TviB; Provi | 91.78 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 91.71 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 91.67 | |
| KOG1371 | 343 | consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo | 91.67 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 91.66 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 91.65 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 91.63 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 91.62 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 91.61 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 91.6 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 91.6 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 91.6 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 91.58 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 91.56 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 91.53 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 91.52 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.51 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 91.44 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 91.42 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 91.41 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 91.41 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 91.38 | |
| PRK05717 | 255 | oxidoreductase; Validated | 91.38 | |
| COG0059 | 338 | IlvC Ketol-acid reductoisomerase [Amino acid trans | 91.37 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 91.36 | |
| PRK14179 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 91.31 |
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
Probab=99.72 E-value=7.9e-18 Score=129.78 Aligned_cols=80 Identities=26% Similarity=0.301 Sum_probs=63.2
Q ss_pred ccCCCCCCCcccccCCC--cchhhcccc---------chhhhhhhccccCCCCCCCCCCCCCCCCCceEEEECCCHHHHH
Q 046976 6 LLPATSVTGVKWSRVQV--KGPRFHVRA---------SLDTNVSDMSVNAPKGLFLPEPEHYRGPKLKVAIIGAGLAGMS 74 (89)
Q Consensus 6 ~~~~~~~~~~~~~iC~~--~C~~~c~r~---------~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~IvG~G~aGl~ 74 (89)
.+.+|||+.+||+|||| +||..|+|+ .+++|+.|..... .+.+..+.. ...++|+|||+||+|++
T Consensus 79 ~~~~np~p~~~grvC~~~~~Ce~~C~r~~~~~~v~I~~l~r~~~~~~~~~--~~~~~~~~~--~~~~~V~IIG~GpAGl~ 154 (464)
T PRK12831 79 IAKYNALPAVCGRVCPQESQCEGKCVLGIKGEPVAIGKLERFVADWAREN--GIDLSETEE--KKGKKVAVIGSGPAGLT 154 (464)
T ss_pred HHHhCCchhhhhccCCCCCChHHHhcCCCCCCCeehhHHHHHHHHHHHHc--CCCCCCCcC--CCCCEEEEECcCHHHHH
Confidence 34579999999999998 999999997 4678888876542 222211211 23589999999999999
Q ss_pred HHHHHHHCCCceEEc
Q 046976 75 TAVELLDHGHEVLLI 89 (89)
Q Consensus 75 aA~~L~~~G~~V~v~ 89 (89)
+|++|+++|++|+||
T Consensus 155 aA~~l~~~G~~V~v~ 169 (464)
T PRK12831 155 CAGDLAKMGYDVTIF 169 (464)
T ss_pred HHHHHHhCCCeEEEE
Confidence 999999999999986
|
|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00188 adrenodoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >PTZ00367 squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08401 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK07121 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >PRK06481 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >PRK12842 putative succinate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PRK12834 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08626 fumarate reductase flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06854 adenylylsulfate reductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK08275 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK02106 choline dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02815 L-aspartate oxidase | Back alignment and domain information |
|---|
| >PF14691 Fer4_20: Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster; PDB: 2VDC_G 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK06134 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08071 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12843 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07395 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09077 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >COG3573 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07512 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >COG0029 NadB Aspartate oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02785 Protein HOTHEAD | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >KOG2852 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >COG4529 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >KOG2853 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC | Back alignment and domain information |
|---|
| >KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK06849 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 89 | |||
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 1e-07 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 1e-07 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 2e-07 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 3e-07 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 3e-07 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 4e-07 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 4e-07 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 5e-07 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 5e-07 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 5e-07 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 5e-07 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 7e-07 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 9e-07 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 1e-06 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 1e-06 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 1e-06 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 2e-06 | |
| 3utf_A | 513 | UDP-galactopyranose mutase; nucleotide binding, fl | 3e-06 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 3e-06 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 3e-06 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 4e-06 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 6e-06 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 7e-06 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 7e-06 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 7e-06 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 9e-06 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 1e-05 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 1e-05 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 1e-05 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 2e-05 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 2e-05 | |
| 2e5v_A | 472 | L-aspartate oxidase; archaea, oxidoreductase; HET: | 2e-05 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 2e-05 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 2e-05 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 2e-05 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 3e-05 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 3e-05 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 3e-05 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 5e-04 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 4e-05 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 4e-05 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 4e-05 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 5e-05 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 5e-05 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 5e-05 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 6e-05 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 7e-05 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 7e-05 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 7e-05 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 7e-05 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 7e-05 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 1e-04 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 1e-04 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 1e-04 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 1e-04 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 1e-04 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 1e-04 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 1e-04 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 1e-04 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 1e-04 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 2e-04 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 2e-04 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 2e-04 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 2e-04 | |
| 1chu_A | 540 | Protein (L-aspartate oxidase); flavoenzyme, NAD bi | 2e-04 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 2e-04 | |
| 2wdq_A | 588 | Succinate dehydrogenase flavoprotein subunit; succ | 3e-04 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 3e-04 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 3e-04 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 3e-04 | |
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 3e-04 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 3e-04 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 3e-04 | |
| 2h88_A | 621 | Succinate dehydrogenase flavoprotein subunit; comp | 4e-04 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 4e-04 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 5e-04 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 5e-04 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 6e-04 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 6e-04 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 8e-04 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 7e-04 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 8e-04 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 8e-04 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 9e-04 |
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 | Back alignment and structure |
|---|
Score = 46.8 bits (111), Expect = 1e-07
Identities = 10/28 (35%), Positives = 18/28 (64%)
Query: 62 KVAIIGAGLAGMSTAVELLDHGHEVLLI 89
V ++G G AG+ +A EL G++V ++
Sbjct: 13 SVVVLGGGPAGLCSAFELQKAGYKVTVL 40
|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 | Back alignment and structure |
|---|
| >3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 | Back alignment and structure |
|---|
| >2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Length = 472 | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Length = 155 | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Length = 218 | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 | Back alignment and structure |
|---|
| >1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Length = 540 | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 | Back alignment and structure |
|---|
| >2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Length = 588 | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Length = 660 | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 | Back alignment and structure |
|---|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Length = 359 | Back alignment and structure |
|---|
| >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Length = 621 | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Length = 245 | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 89 | |||
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 99.65 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 99.5 | |
| 3fpz_A | 326 | Thiazole biosynthetic enzyme; FAD, mitochondrion, | 99.2 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 99.1 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 99.06 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 98.84 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 98.81 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 98.78 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 98.77 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 98.71 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 98.69 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 98.69 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 98.65 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 98.64 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 98.61 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 98.6 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 98.56 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 98.55 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 98.52 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 98.5 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 98.49 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 98.48 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 98.46 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 98.46 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 98.45 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 98.45 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 98.45 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 98.45 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 98.44 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 98.42 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 98.42 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 98.42 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 98.42 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 98.41 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 98.41 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 98.4 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 98.4 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 98.4 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 98.4 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 98.39 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 98.39 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 98.39 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 98.38 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 98.38 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 98.37 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 98.37 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 98.37 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 98.36 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 98.36 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 98.35 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 98.35 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 98.35 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 98.35 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 98.34 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 98.34 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 98.34 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 98.34 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 98.33 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 98.33 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 98.33 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 98.33 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 98.33 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 98.33 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 98.33 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 98.32 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 98.32 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 98.32 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 98.32 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 98.32 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 98.32 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 98.31 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 98.31 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 98.3 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 98.3 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 98.29 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.29 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.29 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 98.29 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 98.28 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 98.28 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 98.28 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 98.27 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 98.27 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 98.27 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 98.26 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 98.26 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 98.26 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 98.25 | |
| 2gjc_A | 326 | Thiazole biosynthetic enzyme, mitochondrial; gluta | 98.25 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 98.25 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 98.24 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 98.24 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 98.23 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 98.22 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 98.22 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 98.22 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 98.21 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 98.21 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 98.2 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 98.2 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 98.2 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 98.2 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 98.19 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 98.19 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 98.19 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 98.19 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 98.18 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 98.18 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 98.18 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 98.17 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 98.17 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 98.17 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 98.17 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 98.17 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 98.17 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 98.16 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 98.16 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 98.16 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 98.16 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 98.16 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 98.15 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 98.15 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 98.15 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 98.14 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 98.14 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 98.13 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 98.13 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 98.13 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 98.13 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 98.13 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 98.12 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 98.12 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 98.12 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 98.11 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 98.1 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 98.1 | |
| 2wdq_A | 588 | Succinate dehydrogenase flavoprotein subunit; succ | 98.1 | |
| 2h88_A | 621 | Succinate dehydrogenase flavoprotein subunit; comp | 98.1 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 98.09 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 98.09 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 98.09 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 98.08 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 98.08 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 98.08 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 98.08 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 98.07 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 98.07 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 98.07 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 98.06 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 98.06 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 98.05 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 98.05 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 98.05 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 98.04 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 98.04 | |
| 3g5s_A | 443 | Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy | 98.04 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 98.03 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 98.03 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 98.02 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 98.02 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 98.02 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 98.02 | |
| 3pl8_A | 623 | Pyranose 2-oxidase; substrate complex, H167A mutan | 98.0 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 98.0 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 97.99 | |
| 1chu_A | 540 | Protein (L-aspartate oxidase); flavoenzyme, NAD bi | 97.98 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 97.98 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 97.97 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 97.96 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 97.94 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 97.93 | |
| 1kdg_A | 546 | CDH, cellobiose dehydrogenase; GMC oxidoreductase, | 97.93 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 97.92 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 97.92 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 97.92 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 97.91 | |
| 3gyx_A | 662 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 97.91 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 97.91 | |
| 1jnr_A | 643 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 97.9 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 97.9 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 97.9 | |
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 97.9 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 97.89 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 97.88 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 97.87 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 97.86 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 97.84 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 97.84 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 97.82 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 97.81 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 97.8 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 97.77 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 97.76 | |
| 3t37_A | 526 | Probable dehydrogenase; BET alpha beta fold, ADP b | 97.76 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 97.65 | |
| 1ju2_A | 536 | HydroxynitrIle lyase; flavin, GMC oxidoreductase, | 97.52 | |
| 1n4w_A | 504 | CHOD, cholesterol oxidase; flavoenzyme, steroid me | 97.5 | |
| 1coy_A | 507 | Cholesterol oxidase; oxidoreductase(oxygen recepto | 97.45 | |
| 3q9t_A | 577 | Choline dehydrogenase and related flavoproteins; g | 97.35 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 97.22 | |
| 2jbv_A | 546 | Choline oxidase; alcohol oxidation, flavoenyzme ox | 97.2 | |
| 1gpe_A | 587 | Protein (glucose oxidase); oxidoreductase(flavopro | 97.2 | |
| 4b63_A | 501 | L-ornithine N5 monooxygenase; oxidoreductase, side | 97.19 | |
| 3qvp_A | 583 | Glucose oxidase; oxidoreductase; HET: NAG BMA MAN | 97.19 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 97.15 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 97.14 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 97.12 | |
| 3fim_B | 566 | ARYL-alcohol oxidase; AAO, lignin degradation, oxi | 97.11 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 97.08 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 97.06 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 97.0 | |
| 2x5o_A | 439 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; A | 96.99 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 96.97 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.97 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 96.93 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 96.93 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 96.93 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 96.91 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.9 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 96.85 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 96.84 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 96.83 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 96.78 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 96.77 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 96.76 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 96.72 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 96.72 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 96.65 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 96.64 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 96.61 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 96.59 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 96.59 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 96.57 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 96.57 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 96.55 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 96.52 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 96.52 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 96.5 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 96.49 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 96.49 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 96.49 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 96.48 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 96.48 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 96.46 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 96.45 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 96.43 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 96.4 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 96.4 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 96.39 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 96.37 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 96.37 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 96.36 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 96.35 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 96.35 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 96.35 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 96.35 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 96.35 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 96.33 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 96.33 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 96.33 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 96.32 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 96.31 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 96.31 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 96.3 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 96.3 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 96.28 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 96.28 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 96.28 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 96.26 | |
| 3vtf_A | 444 | UDP-glucose 6-dehydrogenase; two discrete alpha/be | 96.25 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 96.23 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 96.23 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 96.22 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 96.22 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 96.21 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 96.21 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 96.21 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 96.2 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 96.19 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 96.19 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 96.19 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 96.19 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 96.17 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 96.16 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 96.16 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 96.14 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 96.09 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 96.09 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 96.05 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 96.04 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 96.04 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 96.04 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 96.01 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 96.0 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 95.99 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 95.95 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 95.95 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 95.94 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 95.91 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 95.91 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 95.91 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 95.89 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 95.88 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 95.88 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 95.86 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 95.86 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 95.86 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 95.85 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 95.83 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 95.83 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 95.82 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 95.81 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 95.81 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 95.8 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 95.79 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 95.79 | |
| 4ffl_A | 363 | PYLC; amino acid, biosynthesis of pyrrolysine, iso | 95.79 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 95.76 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 95.76 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 95.75 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 95.74 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 95.72 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 95.72 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 95.71 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 95.7 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 95.68 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 95.68 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 95.64 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 95.6 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 95.57 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 95.56 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 95.52 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 95.51 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 95.49 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 95.49 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 95.48 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 95.47 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 95.46 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 95.45 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 95.42 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 95.42 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 95.39 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 95.39 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 95.39 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 95.37 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 95.36 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 95.35 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 95.35 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 95.34 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 95.34 | |
| 3c7a_A | 404 | Octopine dehydrogenase; L) stereospecific opine de | 95.33 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 95.3 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 95.3 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 95.27 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 95.22 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 95.2 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 95.19 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 95.17 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 95.09 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 95.08 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 95.08 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 95.08 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 95.06 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 95.06 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 95.03 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 95.02 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 95.01 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 95.01 | |
| 3ojo_A | 431 | CAP5O; rossmann fold, complex with cofactor NAD an | 95.01 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 94.99 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 94.97 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 94.95 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 94.93 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 94.93 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 94.92 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 94.92 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 94.88 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 94.88 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 94.86 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 94.85 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 94.83 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 94.8 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 94.8 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 94.77 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 94.76 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 94.75 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 94.72 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 94.71 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 94.67 | |
| 4b63_A | 501 | L-ornithine N5 monooxygenase; oxidoreductase, side | 94.63 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 94.62 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 94.59 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 94.57 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 94.57 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 94.56 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 94.54 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 94.51 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 94.49 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 94.49 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 94.49 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 94.47 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 94.47 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 94.46 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 94.46 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 94.46 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 94.44 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 94.44 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 94.42 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 94.42 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 94.41 | |
| 1yj8_A | 375 | Glycerol-3-phosphate dehydrogenase; SGPP, structur | 94.4 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 94.39 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 94.35 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 94.34 | |
| 4hv4_A | 494 | UDP-N-acetylmuramate--L-alanine ligase; MURC, yers | 94.33 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 94.33 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 94.32 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 94.31 | |
| 1x0v_A | 354 | GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase | 94.3 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 94.27 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 94.25 | |
| 3dfu_A | 232 | Uncharacterized protein from 6-phosphogluconate de | 94.24 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 94.23 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 94.22 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 94.21 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 94.2 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 94.16 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 94.13 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 94.11 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 94.11 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 94.06 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 94.03 | |
| 3ax6_A | 380 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 94.03 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 94.01 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 94.01 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 94.01 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 93.98 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 93.97 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 93.97 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 93.94 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 93.91 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 93.9 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 93.89 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 93.88 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 93.86 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 93.83 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 93.82 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 93.81 | |
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 93.81 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 93.74 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 93.73 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 93.72 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 93.72 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 93.69 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 93.69 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 93.67 | |
| 2qrj_A | 394 | Saccharopine dehydrogenase, NAD+, L-lysine- formin | 93.67 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 93.67 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 93.65 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 93.61 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 93.58 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 93.57 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 93.55 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 93.55 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 93.54 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 93.52 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 93.51 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 93.5 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 93.5 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 93.44 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 93.42 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 93.36 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 93.35 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 93.35 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 93.32 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 93.28 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 93.26 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 93.26 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 93.2 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 93.19 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 93.18 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 93.18 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 93.18 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 93.17 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 93.16 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 93.12 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 93.12 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 93.11 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 93.1 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 93.1 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 93.1 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 93.09 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 93.07 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 93.07 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 93.04 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 93.01 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 93.01 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 92.99 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 92.98 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 92.98 |
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
Probab=99.65 E-value=4.9e-17 Score=123.54 Aligned_cols=81 Identities=22% Similarity=0.243 Sum_probs=61.1
Q ss_pred ccCCCCCCCcccccCCC--cchhhccccc----------hhhhhhhccccCCCCCCCCCCCCCCCCCceEEEECCCHHHH
Q 046976 6 LLPATSVTGVKWSRVQV--KGPRFHVRAS----------LDTNVSDMSVNAPKGLFLPEPEHYRGPKLKVAIIGAGLAGM 73 (89)
Q Consensus 6 ~~~~~~~~~~~~~iC~~--~C~~~c~r~~----------l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~IvG~G~aGl 73 (89)
.+.+|||+++|||+||+ +||..|+|+. +++++.|..+. .++.++.+... ...++|+|||+||+|+
T Consensus 59 ~~~~n~~p~~~grvCp~~~~Ce~~C~~~~~~~~~v~I~~le~~~~~~~~~--~~~~~~~~~~~-~~~~~V~IIGgGpAGl 135 (456)
T 2vdc_G 59 SQATNNFPEICGRICPQDRLCEGNCVIEQSTHGAVTIGSVEKYINDTAWD--QGWVKPRTPSR-ELGLSVGVIGAGPAGL 135 (456)
T ss_dssp HHHHCSCHHHHHHHCCGGGSGGGGCGGGGSSSCSCCHHHHHHHHHHHHHH--HTCCCCCCSCS-SCCCCEEEECCSHHHH
T ss_pred HHhhCCCCccccccCCCCcchHHhcccCCCCCCCccHHHHHHHHHHHHHH--cCCCCCCCCcC-CCCCEEEEECCCHHHH
Confidence 45579999999999999 9999999874 34555554443 23333222111 1247999999999999
Q ss_pred HHHHHHHHCCCceEEc
Q 046976 74 STAVELLDHGHEVLLI 89 (89)
Q Consensus 74 ~aA~~L~~~G~~V~v~ 89 (89)
++|+.|+++|++|+||
T Consensus 136 ~aA~~L~~~G~~V~v~ 151 (456)
T 2vdc_G 136 AAAEELRAKGYEVHVY 151 (456)
T ss_dssp HHHHHHHHHTCCEEEE
T ss_pred HHHHHHHHCCCeEEEE
Confidence 9999999999999986
|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* | Back alignment and structure |
|---|
| >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* | Back alignment and structure |
|---|
| >3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* | Back alignment and structure |
|---|
| >3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* | Back alignment and structure |
|---|
| >1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 | Back alignment and structure |
|---|
| >4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* | Back alignment and structure |
|---|
| >3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 89 | ||||
| d2bi7a1 | 314 | c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu | 3e-09 | |
| d2ivda1 | 347 | c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox | 4e-08 | |
| d2iida1 | 370 | c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M | 4e-08 | |
| d2dw4a2 | 449 | c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist | 5e-08 | |
| d1i8ta1 | 298 | c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu | 7e-08 | |
| d1c0pa1 | 268 | c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida | 1e-07 | |
| d1seza1 | 373 | c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox | 1e-07 | |
| d1y0pa2 | 308 | c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( | 3e-07 | |
| d1qo8a2 | 317 | c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( | 4e-07 | |
| d1kifa1 | 246 | c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N | 4e-07 | |
| d1w4xa1 | 298 | c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy | 4e-07 | |
| d1k0ia1 | 292 | c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr | 5e-07 | |
| d2voua1 | 265 | c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr | 5e-07 | |
| d1d4ca2 | 322 | c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( | 5e-07 | |
| d2bs2a2 | 336 | c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo | 5e-07 | |
| d2gf3a1 | 281 | c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac | 6e-07 | |
| d1ryia1 | 276 | c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { | 7e-07 | |
| d2v5za1 | 383 | c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H | 7e-07 | |
| d2i0za1 | 251 | c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B | 1e-06 | |
| d1d5ta1 | 336 | c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di | 1e-06 | |
| d1lqta2 | 239 | c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct | 2e-06 | |
| d1neka2 | 330 | c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase | 2e-06 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 2e-06 | |
| d2gqfa1 | 253 | c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H | 5e-06 | |
| d2bcgg1 | 297 | c.3.1.3 (G:5-301) Guanine nucleotide dissociation | 5e-06 | |
| d1pj5a2 | 305 | c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox | 7e-06 | |
| d1gtea4 | 196 | c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de | 7e-06 | |
| d2gv8a1 | 335 | c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox | 1e-05 | |
| d1cjca2 | 230 | c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase | 1e-05 | |
| d1mv8a2 | 202 | c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pse | 1e-05 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 2e-05 | |
| d1bg6a2 | 184 | c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin | 6e-05 | |
| d1jnra2 | 356 | c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct | 1e-04 | |
| d1kf6a2 | 311 | c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es | 1e-04 | |
| d1nhpa1 | 198 | c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter | 1e-04 | |
| d1chua2 | 305 | c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E | 2e-04 | |
| d1txga2 | 180 | c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogen | 2e-04 | |
| d1vdca1 | 192 | c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase | 3e-04 | |
| d1e5qa1 | 182 | c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase | 4e-04 | |
| d1fl2a1 | 184 | c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide | 4e-04 | |
| d2f1ka2 | 165 | c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {S | 4e-04 | |
| d1ojta1 | 229 | c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh | 4e-04 | |
| d1fcda1 | 186 | c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf | 4e-04 | |
| d1d7ya1 | 183 | c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo | 5e-04 | |
| d1pn0a1 | 360 | c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So | 5e-04 | |
| d1ebda1 | 223 | c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd | 5e-04 | |
| d1f0ya2 | 192 | c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA | 6e-04 | |
| d1h6va1 | 235 | c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin | 6e-04 | |
| d1onfa1 | 259 | c.3.1.5 (A:1-153,A:271-376) Glutathione reductase | 7e-04 | |
| d1v59a1 | 233 | c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd | 8e-04 | |
| d1ks9a2 | 167 | c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Esc | 8e-04 | |
| d1wdka3 | 186 | c.2.1.6 (A:311-496) Fatty oxidation complex alpha | 9e-04 | |
| d1n1ea2 | 189 | c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogen | 0.001 | |
| d1q1ra1 | 185 | c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas | 0.001 | |
| d1dxla1 | 221 | c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd | 0.001 | |
| d3lada1 | 229 | c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd | 0.001 | |
| d2gmha1 | 380 | c.3.1.2 (A:4-236,A:336-482) Electron transfer flav | 0.001 | |
| d1trba1 | 190 | c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase | 0.001 | |
| d1lvla1 | 220 | c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd | 0.001 | |
| d1m6ia1 | 213 | c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f | 0.002 | |
| d1gesa1 | 217 | c.3.1.5 (A:3-146,A:263-335) Glutathione reductase | 0.002 | |
| d1rp0a1 | 278 | c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi | 0.002 | |
| d1t2da1 | 150 | c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria p | 0.002 | |
| d1a5za1 | 140 | c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermoto | 0.002 | |
| d1xhca1 | 167 | c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite | 0.003 | |
| d1dlja2 | 196 | c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGD | 0.003 | |
| d1qyca_ | 307 | c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta | 0.003 | |
| d3grsa1 | 221 | c.3.1.5 (A:18-165,A:291-363) Glutathione reductase | 0.004 | |
| d2gjca1 | 311 | c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th | 0.004 | |
| d1lssa_ | 132 | c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus ja | 0.004 | |
| d2f5va1 | 379 | c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W | 0.004 |
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-binding domain superfamily: Nucleotide-binding domain family: UDP-galactopyranose mutase, N-terminal domain domain: UDP-galactopyranose mutase, N-terminal domain species: Klebsiella pneumoniae [TaxId: 573]
Score = 49.4 bits (117), Expect = 3e-09
Identities = 11/28 (39%), Positives = 18/28 (64%)
Query: 62 KVAIIGAGLAGMSTAVELLDHGHEVLLI 89
K+ I+GAG +G +L + GH+V +I
Sbjct: 4 KILIVGAGFSGAVIGRQLAEKGHQVHII 31
|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 | Back information, alignment and structure |
|---|
| >d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 202 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 180 | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182 | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 165 | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Length = 167 | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Length = 186 | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Length = 189 | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 150 | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 140 | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Length = 196 | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 132 | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 89 | |||
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 99.43 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 99.13 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.13 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 99.08 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 99.08 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 99.03 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 99.01 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 98.93 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 98.89 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 98.88 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 98.83 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 98.82 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 98.82 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 98.82 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 98.78 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 98.78 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 98.75 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 98.74 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 98.74 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 98.73 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 98.73 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 98.73 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 98.72 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 98.71 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 98.69 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 98.69 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 98.68 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 98.65 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 98.64 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 98.63 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 98.63 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 98.62 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 98.61 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 98.58 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 98.56 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 98.56 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 98.55 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 98.54 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 98.52 | |
| d1aoga1 | 238 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 98.51 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 98.48 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 98.47 | |
| d1feca1 | 240 | Trypanothione reductase {Crithidia fasciculata [Ta | 98.42 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 98.4 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 98.4 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 98.38 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 98.38 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 98.38 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 98.38 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 98.37 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 98.36 | |
| d1jnra2 | 356 | Adenylylsulfate reductase A subunit {Archaeon Arch | 98.29 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 98.25 | |
| d1chua2 | 305 | L-aspartate oxidase {Escherichia coli [TaxId: 562] | 98.21 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 98.2 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 98.17 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 98.1 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 98.09 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 98.09 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 98.09 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 98.09 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 98.08 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 98.07 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 98.05 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 98.04 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 98.01 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 98.01 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 97.99 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 97.99 | |
| d1kf6a2 | 311 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 97.98 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 97.97 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 97.96 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 97.96 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 97.9 | |
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 97.89 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 97.84 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 97.82 | |
| d1cf3a1 | 385 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 97.81 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 97.77 | |
| d1ju2a1 | 351 | Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI | 97.68 | |
| d1gtea1 | 182 | Dihydropyrimidine dehydrogenase, N-terminal domain | 97.67 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 97.62 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 97.38 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 97.33 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.28 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 97.24 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 97.18 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 97.18 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.14 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 97.02 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 97.01 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 96.91 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 96.87 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 96.86 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 96.81 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 96.68 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 96.54 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 96.45 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 96.45 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 96.4 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 96.39 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 96.37 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 96.34 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 96.32 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 96.3 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 96.29 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 96.29 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 96.28 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 96.27 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 96.27 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 96.25 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 96.17 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 96.16 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 96.13 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 96.05 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 96.03 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 96.03 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 95.96 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 95.89 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 95.84 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 95.83 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 95.81 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 95.79 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 95.69 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 95.63 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 95.59 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 95.58 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 95.5 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 95.48 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 95.46 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 95.38 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 95.28 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 95.27 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 95.26 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 95.23 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 95.15 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 95.07 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 95.05 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 94.99 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 94.96 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 94.94 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 94.66 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 94.64 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 94.63 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 94.62 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 94.62 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 94.6 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 94.55 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 94.51 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 94.48 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 94.44 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 94.42 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 94.39 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 94.24 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 94.16 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 94.11 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 93.96 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 93.73 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 93.73 | |
| d1np3a2 | 182 | Class I ketol-acid reductoisomerase (KARI) {Pseudo | 93.58 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 93.52 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 93.51 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 93.49 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 93.32 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 93.23 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 93.23 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 93.18 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 93.05 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 93.0 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 92.89 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 92.79 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 92.67 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 92.2 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 92.11 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 92.02 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 91.94 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 91.81 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 91.74 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 91.65 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 91.63 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 91.61 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 91.61 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 91.59 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 91.56 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 91.52 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 91.42 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 91.42 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 91.41 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 91.39 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 91.35 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 91.29 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 91.28 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 91.24 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 91.23 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 91.22 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 91.08 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 91.05 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 91.01 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 90.82 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 90.75 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 90.71 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 90.44 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 90.37 | |
| d1lqta1 | 216 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 90.35 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 90.32 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 90.3 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 90.3 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 90.28 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 90.25 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 90.24 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 90.22 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 90.15 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 90.06 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 90.04 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 89.99 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 89.95 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 89.83 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 89.82 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 89.72 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 89.69 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 89.66 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 89.58 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 89.54 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 89.53 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 89.5 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 89.5 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 89.49 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 89.42 | |
| d1cjca1 | 225 | Adrenodoxin reductase of mitochondrial p450 system | 89.4 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 89.27 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 89.2 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 89.17 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 89.13 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 89.06 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 89.05 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 89.04 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 88.9 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 88.75 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 88.66 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 88.63 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 88.63 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 88.59 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 88.53 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 88.46 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 87.84 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 87.83 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 87.79 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 87.74 | |
| d1vjta1 | 193 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 87.63 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 87.6 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 86.88 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 86.67 | |
| d1u7za_ | 223 | Coenzyme A biosynthesis bifunctional protein CoaBC | 86.2 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 85.71 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 85.55 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 85.39 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 84.8 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 84.74 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 84.52 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 84.3 | |
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 84.22 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 84.18 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 84.1 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 84.04 | |
| d1b26a1 | 234 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 84.04 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 83.87 | |
| d1iuka_ | 136 | Hypothetical protein TT1466 {Thermus thermophilus | 83.62 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 83.46 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 83.38 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 83.29 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 82.83 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 82.78 | |
| d1qmga2 | 226 | Class II ketol-acid reductoisomerase (KARI) {Spina | 82.77 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 82.3 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 81.96 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 81.51 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 80.88 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 80.33 |
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-binding domain superfamily: Nucleotide-binding domain family: N-terminal domain of adrenodoxin reductase-like domain: 2,4-dienoyl-CoA reductase, middle domain species: Escherichia coli [TaxId: 562]
Probab=99.43 E-value=8.1e-14 Score=93.82 Aligned_cols=31 Identities=39% Similarity=0.665 Sum_probs=29.3
Q ss_pred CCceEEEECCCHHHHHHHHHHHHCCCceEEc
Q 046976 59 PKLKVAIIGAGLAGMSTAVELLDHGHEVLLI 89 (89)
Q Consensus 59 ~~~~v~IvG~G~aGl~aA~~L~~~G~~V~v~ 89 (89)
..++|+|||+|||||+||++|+++||+|+||
T Consensus 42 ~~k~V~IIGaGPAGL~AA~~la~~G~~Vtl~ 72 (179)
T d1ps9a3 42 QKKNLAVVGAGPAGLAFAINAAARGHQVTLF 72 (179)
T ss_dssp SCCEEEEECCSHHHHHHHHHHHTTTCEEEEE
T ss_pred CCcEEEEECccHHHHHHHHHHHhhccceEEE
Confidence 3589999999999999999999999999997
|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} | Back information, alignment and structure |
|---|
| >d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|