Citrus Sinensis ID: 047004

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------

MGSLPGFKSMLEVEDDWYVTGNTSLNNHQDITFPPNLGDPTTDNLLLNAVDSSSSCSPSSSVFNNFDASQVHYFLPQKNSFSSFMNVVSNNNSLEHGFDLGEMGFLDTQATHALNRGNGGILNGFNDLSANNQMNATNLCSDPQFGTNRTLQFPENGSSSFTGFRGFDENNGNSLFLNRSKLLRPLETFPSTGAQPTLFQKRAALRKNLGGNEASLGVLGTQNSQLLCGIESDKGKKELTEDNEKKRKLSISDDLEDVSVDGSGLNYDSDDFLENNKVEEMGKNGGSISNAISTITGGDQKGKKKGLPAKNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASILGDAIEYLKELLQRINDLHNELESTPPGSALTPSTSFYPLTPTPPALHSRIKDELCPSSLPSPNGQPARVEVRVREGRAVNIHMFCSRRPGLLLSTMRALDNLGLDIQQAVISCFNGFAMDVFRAEQCKEGQDVHPEQIKAVLLDSAGFHGMM

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccEEEEEEEccccccHHHHHHHHHHccccEEEEEEEEEEccEEEEEEEEEEccccccccHHHHHHHHHHHccccccc

*****GFKSMLEVEDDWYVTGNT*LNNHQDITF**NLGDPTTDNL*****************FNNFDASQVHYFLPQKNSFSSFMNVVSNNNSLEHGFDLGEMGFLDTQATHALNRGNGGILNGFNDLS*********************************************LFLNR*KLL***************************************************************************************************************************************RKKLNDRLYMLRSVVPKISKMDRASILGDAIEYLKELLQRINDL*****************************************************VRVREGRAVNIHMFCSRRPGLLLSTMRALDNLGLDIQQAVISCFNGFAMDVFRAEQCKEGQDVHPEQIKAVLLDSAGFHG**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGSLPGFKSMLEVEDDWYVTGNTSLNNHQDITFPPNLGDPTTDNLLLNAVDSSSSCSPSSSVFNNFDASQVHYFLPQKNSFSSFMNVVSNNNSLEHGFDLGEMGFLDTQATHALNRGNGGILNGFNDLSANNQMNATNLCSDPQFGTNRTLQFPENGSSSFTGFRGFDENNGNSLFLNRSKLLRPLETFPSTGAQPTLFQKRAALRKNLGGNEASLGVLGTQNSQLLCGIESDKGKKELTEDNEKKRKLSISDDLEDVSVDGSGLNYDSDDFLENNKVEEMGKNGGSISNAISTITGGDQKGKKKGLPAKNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASIxxxxxxxxxxxxxxxxxxxxxxxxxPPGSALTPSTSFYPLTPTPPALHSRIKDELCPSSLPSPNGQPARVEVRVREGRAVNIHMFCSRRPGLLLSTMRALDNLGLDIQQAVISCFNGFAMDVFRAEQCKEGQDVHPEQIKAVLLDSAGFHGMM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor ICE1	Transcriptional activator that regulates the cold-induced transcription of CBF/DREB1 genes. Binds specifically to the MYC recognition sites (5'-CANNTG-3') found in the CBF3/DREB1A promoter. Mediates stomatal differentiation in the epidermis probably by controlling successive roles of SPCH, MUTE, and FAMA.	probable	Q9LSE2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AM9, chain A
Confidence level:confident
Coverage over the Query: 307-370
View the alignment between query and template
View the model in PyMOL

Template: 3P96, chain A
Confidence level:probable
Coverage over the Query: 423-496
View the alignment between query and template
View the model in PyMOL