Citrus Sinensis ID: 047033


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510----
SLSLAFSLSSSFSLMAAIPNPTLQSPSTCFLKPCSDSLPNLGFSISVSFSPSVSSSLSKSNKIFLHSEPKKLAVSARSADENITEGTFTSRSTNRTNVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVMEQLQKLVNVLKVEDLSNEPQVERELMLIKVNADPKFRAEIFLFPCLGVHLQIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKLGASAPFWRFSAASYPDLNETPTIDGLVGAGHRPLLSETDTVEGDVYPVEPSDGLTVNQVLDPHWGVLNDDDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL
ccccEEEccccccEEEEccccccccccEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEEEECccccHHHHHHHHHHcccccccEEEECccccccEEEEEEEcccHHHHHHHHHHHccccEEEEECccccccEEEEEEEEEEEcccccccEEEccccccccHHHHHHHHccccEEEECcccEEEEEEEccHHHHHHHHHHHccccEEEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccCEEEEEEEECccccHHHHHHHHHcccccccEEEEEEccccccccEEEEEEEcccHHHHHHHHHHHccccEEEEECccccccEEEEEEEEEEEcccccHHHHHHHHHHcccEEEECcccEEEEEEEccHHHHHHHHHHHccccCEEEEEEcHHHHcccccccccccccccccc
*******LSSSFSLMAAIPNPTLQSPSTCFLKPCSDSLPNLGFSI****************************************************VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVMEQLQKLVNVLKVEDLSNEPQVERELMLIKVNADPKFRAEIFLFPCLGVHLQIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKLGASAPFWRFSAASYPDLNETP*********************GDVYPVEPSDGLTVNQVLDPHWGVLNDDDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGVDSKYLRG*SFP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLSLAFSLSSSFSLMAAIPNPTLQSPSTCFLKPCSDSLPNLGFSISVSFSPSVSSSLSKSNKIFLHSEPKKLAVSARSADENITEGTFTSRSTNRTNVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVMEQLQKLVNVLKVEDLSNEPQVERELMLIKVNADPKFRAEIFLFPCLGVHLQIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREKLGASAPFWRFSAASYPDLNETPTIDGLVGAGHRPLLSETDTVEGDVYPVEPSDGLTVNQVLDPHWGVLNDDDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acetolactate synthase small subunit 2, chloroplastic Regulatory subunit of acetohydroxy-acid synthase. Involved in the feed-back inhibition by branched-chain amino acids. Contains 2 repeats, each of them being able to activate partially the catalytic subunit. The enzyme reconstituted with the first repeat is inhibited by leucine, but not by valine or isoleucine and the enzyme reconstituted with the second repeat is not inhibited by any branched-chain amino acid.confidentQ93YZ7
Acetolactate synthase small subunit 1, chloroplastic Regulatory subunit of acetohydroxy-acid synthase. Probably involved in feedback inhibition by branched-chain amino acids. Not involved in herbicide tolerance.probableQ9SMC2
Acetolactate synthase small subunit 1, chloroplastic Regulatory subunit of acetohydroxy-acid synthase. Involved in the feed-back inhibition by branched-chain amino acids but not in herbicide tolerance.probableQ9FFF4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PC6, chain A
Confidence level:very confident
Coverage over the Query: 100-196,210-267
View the alignment between query and template
View the model in PyMOL
Template: 2PC6, chain A
Confidence level:very confident
Coverage over the Query: 344-501
View the alignment between query and template
View the model in PyMOL
Template: 3L76, chain A
Confidence level:probable
Coverage over the Query: 106-254,265-270,282-283,324-485
View the alignment between query and template
View the model in PyMOL