Citrus Sinensis ID: 047033
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 514 | ||||||
| 255577893 | 493 | acetolactate synthase, putative [Ricinus | 0.850 | 0.886 | 0.784 | 0.0 | |
| 356511027 | 476 | PREDICTED: uncharacterized protein LOC10 | 0.793 | 0.857 | 0.836 | 0.0 | |
| 356528404 | 474 | PREDICTED: uncharacterized protein LOC10 | 0.793 | 0.860 | 0.824 | 0.0 | |
| 225434187 | 482 | PREDICTED: uncharacterized protein LOC10 | 0.902 | 0.962 | 0.735 | 0.0 | |
| 30685071 | 491 | ACT domain-containing small subunit of a | 0.943 | 0.987 | 0.710 | 0.0 | |
| 357519313 | 478 | Acetolactate synthase small subunit [Med | 0.787 | 0.847 | 0.818 | 0.0 | |
| 297822923 | 492 | hypothetical protein ARALYDRAFT_482103 [ | 0.943 | 0.985 | 0.716 | 0.0 | |
| 388506728 | 478 | unknown [Lotus japonicus] | 0.780 | 0.838 | 0.816 | 0.0 | |
| 147792338 | 451 | hypothetical protein VITISV_043824 [Viti | 0.793 | 0.904 | 0.809 | 0.0 | |
| 359495876 | 476 | PREDICTED: uncharacterized protein LOC10 | 0.813 | 0.878 | 0.788 | 0.0 |
| >gi|255577893|ref|XP_002529819.1| acetolactate synthase, putative [Ricinus communis] gi|223530696|gb|EEF32568.1| acetolactate synthase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 724 bits (1868), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 357/455 (78%), Positives = 394/455 (86%), Gaps = 18/455 (3%)
Query: 66 HSEPKKLAVSARSADENITEGTFTSR-----STNRTNVRRHTISVFVGDESGMINRIAGV 120
H +P++ + + +AD + + +S + + VRRHTISVFVGDESGMINRIAGV
Sbjct: 51 HYQPRRKFIVSATADSHKDDTVLSSNGSVPAAATLSKVRRHTISVFVGDESGMINRIAGV 110
Query: 121 FARRGYNIESLAVGLNKDKALFTIVVYGTDKVLQQVMEQLQKLVNVLKVEDLSNEPQVER 180
FARRGYNIESLAVGLNKDKALFTIVV GT++VLQQV+EQLQKLVNV+KVEDLS+EPQVER
Sbjct: 111 FARRGYNIESLAVGLNKDKALFTIVVSGTERVLQQVVEQLQKLVNVMKVEDLSSEPQVER 170
Query: 181 ELMLIKVNADPKFRAEIFLFPCLGVHLQIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMV 240
ELMLIKVNADP +RAEI WLV IFRAKIVDISE+SLTIEVTGDPGKMV
Sbjct: 171 ELMLIKVNADPSYRAEIM------------WLVGIFRAKIVDISEHSLTIEVTGDPGKMV 218
Query: 241 AVQRNLSKFGIREIARTGKIALRREKLGASAPFWRFSAASYPDLNETPTIDGLVGAGHRP 300
AVQRNLSKFGIREIARTGKIALRREK+G APFWRFSAASYPDL E + D L+G+ R
Sbjct: 219 AVQRNLSKFGIREIARTGKIALRREKMGECAPFWRFSAASYPDLGEIRSEDALLGSKSRA 278
Query: 301 LLSETDT-VEGDVYPVEPSDGLTVNQVLDPHWGVLNDDDTSGLRSHTLSMLVNDSPGVLN 359
+L + +T GDVYPVE SD + QVLD HWGVLN++DT+GLRSHTLSMLVNDSPGVLN
Sbjct: 279 VLGDDETSAGGDVYPVETSDSFMLTQVLDAHWGVLNEEDTTGLRSHTLSMLVNDSPGVLN 338
Query: 360 IVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLT 419
IVTG+FARRGYN+QSLAVGH+ETEGLSRITTVVP TDESISKL+QQLYKLIDLHEVRDLT
Sbjct: 339 IVTGIFARRGYNVQSLAVGHSETEGLSRITTVVPGTDESISKLVQQLYKLIDLHEVRDLT 398
Query: 420 HLPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRL 479
HLPFAERELMLIK+AVN ARRDVLDIA+IFRAKAVDVSDHTITLELTGDLDKMVALQRL
Sbjct: 399 HLPFAERELMLIKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRL 458
Query: 480 LEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL 514
LEPYGICEVARTGR+ALVRESGVDSKYLRGYSFP+
Sbjct: 459 LEPYGICEVARTGRIALVRESGVDSKYLRGYSFPI 493
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356511027|ref|XP_003524233.1| PREDICTED: uncharacterized protein LOC100779210 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356528404|ref|XP_003532793.1| PREDICTED: uncharacterized protein LOC100810297 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225434187|ref|XP_002279286.1| PREDICTED: uncharacterized protein LOC100261174 [Vitis vinifera] gi|296084341|emb|CBI24729.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|30685071|ref|NP_850172.1| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] gi|75249445|sp|Q93YZ7.1|ILVH2_ARATH RecName: Full=Acetolactate synthase small subunit 2, chloroplastic; AltName: Full=Acetohydroxy-acid synthase small subunit; Short=AHAS; Short=ALS; Flags: Precursor gi|16604523|gb|AAL24267.1| At2g31810/F20M17.15 [Arabidopsis thaliana] gi|21655295|gb|AAM65359.1| At2g31810/F20M17.15 [Arabidopsis thaliana] gi|330253492|gb|AEC08586.1| ACT domain-containing small subunit of acetolactate synthase protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357519313|ref|XP_003629945.1| Acetolactate synthase small subunit [Medicago truncatula] gi|355523967|gb|AET04421.1| Acetolactate synthase small subunit [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297822923|ref|XP_002879344.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. lyrata] gi|297325183|gb|EFH55603.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|388506728|gb|AFK41430.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|147792338|emb|CAN61470.1| hypothetical protein VITISV_043824 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359495876|ref|XP_002266924.2| PREDICTED: uncharacterized protein LOC100256605 [Vitis vinifera] gi|296083398|emb|CBI23353.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 514 | ||||||
| TAIR|locus:2045248 | 491 | AT2G31810 [Arabidopsis thalian | 0.943 | 0.987 | 0.684 | 1.5e-170 | |
| TAIR|locus:2171292 | 477 | VAT1 "VALINE-TOLERANT 1" [Arab | 0.828 | 0.893 | 0.696 | 9.8e-151 | |
| TIGR_CMR|CHY_0518 | 170 | CHY_0518 "acetolactate synthas | 0.295 | 0.894 | 0.524 | 4.4e-36 | |
| TIGR_CMR|DET_0832 | 178 | DET_0832 "acetolactate synthas | 0.299 | 0.865 | 0.454 | 2e-31 | |
| UNIPROTKB|P65161 | 168 | ilvH "Putative acetolactate sy | 0.303 | 0.928 | 0.452 | 2e-31 | |
| TIGR_CMR|GSU_1910 | 163 | GSU_1910 "acetolactate synthas | 0.303 | 0.957 | 0.423 | 1.3e-29 | |
| TIGR_CMR|CHY_1594 | 164 | CHY_1594 "acetolactate synthas | 0.299 | 0.939 | 0.448 | 7.1e-29 | |
| TIGR_CMR|BA_1418 | 169 | BA_1418 "acetolactate synthase | 0.285 | 0.869 | 0.436 | 2e-26 | |
| TIGR_CMR|SPO_2579 | 186 | SPO_2579 "acetolactate synthas | 0.299 | 0.827 | 0.416 | 1.1e-24 | |
| UNIPROTKB|Q9KP91 | 164 | Ptgds2 "Acetolactate synthase | 0.297 | 0.932 | 0.397 | 5.1e-24 |
| TAIR|locus:2045248 AT2G31810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1658 (588.7 bits), Expect = 1.5e-170, P = 1.5e-170
Identities = 345/504 (68%), Positives = 389/504 (77%)
Query: 15 MAAIPNPTLQSPST-CFLKPCSDSLPNLGFXXXXXXXXXXXXXXXXXXXXXXHSEPKKLA 73
MAAI SPS C CSDS P L K++
Sbjct: 1 MAAIS--VSSSPSIRCLRSACSDSSPAL-VSSTRVSFPAKISYLSGISSHRGDEMGKRME 57
Query: 74 VSARSADENITEGXXXXXXXXX--XXXXXHTISVFVGDESGMINRIAGVFARRGYNIESL 131
RS D I++ HTISVFVGDESGMINRIAGVFARRGYNIESL
Sbjct: 58 GFVRSVDGKISDASFSEASSATPKSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESL 117
Query: 132 AVGLNKDKALFTIVVYGTDKVLQQVMEQLQKLVNVLKVEDLSNEPQVERELMLIKVNADP 191
AVGLN+DKALFTIVV GT++VLQQV+EQLQKLVNVLKVED+S+EPQVERELML+KVNA P
Sbjct: 118 AVGLNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHP 177
Query: 192 KFRAEIFLFPCLGVHLQIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGI 251
+ RAEI WLVD FRA++VDI+E++LTIEVTGDPGKM+AV+RNL KF I
Sbjct: 178 ESRAEIM------------WLVDTFRARVVDIAEHALTIEVTGDPGKMIAVERNLKKFQI 225
Query: 252 REIARTGKIALRREKLGASAPFWRFSAASYPDLNETPTIDGLVGAGHRPLLSETDT-VEG 310
REI RTGKIALRREK+GA+APFWRFSAASYPDL E + L + ++ + +T G
Sbjct: 226 REIVRTGKIALRREKMGATAPFWRFSAASYPDLKEQAPVSVLRSSKKGAIVPQKETSAGG 285
Query: 311 DVYPVEPSDGLTVNQVLDPHWGVLNDDDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGY 370
DVYPVEP V+++LD HWG+L D+DTSGLRSHTLS+LVND PGVLNIVTGVFARRGY
Sbjct: 286 DVYPVEPFFDPKVHRILDAHWGLLTDEDTSGLRSHTLSLLVNDIPGVLNIVTGVFARRGY 345
Query: 371 NIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLPFAERELML 430
NIQSLAVGHAET+G+SRITTV+PATDES+SKL+QQLYKL+D+HEV DLTHLPF+ERELML
Sbjct: 346 NIQSLAVGHAETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHLPFSERELML 405
Query: 431 IKVAVNTTARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVAR 490
IK+AVN ARRDVLDIA+IFRAKAVDVSDHTITL+LTGDLDKMVALQRLLEPYGICEVAR
Sbjct: 406 IKIAVNAAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVAR 465
Query: 491 TGRVALVRESGVDSKYLRGYSFPL 514
TGRVAL RESGVDSKYLRGYSFPL
Sbjct: 466 TGRVALARESGVDSKYLRGYSFPL 489
|
|
| TAIR|locus:2171292 VAT1 "VALINE-TOLERANT 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0518 CHY_0518 "acetolactate synthase, small subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0832 DET_0832 "acetolactate synthase, small subunit" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P65161 ilvH "Putative acetolactate synthase small subunit" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1910 GSU_1910 "acetolactate synthase, small subunit" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1594 CHY_1594 "acetolactate synthase, small subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_1418 BA_1418 "acetolactate synthase, small subunit" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_2579 SPO_2579 "acetolactate synthase, small subunit" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KP91 Ptgds2 "Acetolactate synthase III, small subunit" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 514 | |||
| CHL00100 | 174 | CHL00100, ilvH, acetohydroxyacid synthase small su | 2e-71 | |
| PRK11895 | 161 | PRK11895, ilvH, acetolactate synthase 3 regulatory | 1e-67 | |
| PRK11895 | 161 | PRK11895, ilvH, acetolactate synthase 3 regulatory | 1e-67 | |
| CHL00100 | 174 | CHL00100, ilvH, acetohydroxyacid synthase small su | 7e-63 | |
| COG0440 | 163 | COG0440, IlvH, Acetolactate synthase, small (regul | 3e-56 | |
| TIGR00119 | 157 | TIGR00119, acolac_sm, acetolactate synthase, small | 1e-54 | |
| COG0440 | 163 | COG0440, IlvH, Acetolactate synthase, small (regul | 5e-54 | |
| TIGR00119 | 157 | TIGR00119, acolac_sm, acetolactate synthase, small | 2e-53 | |
| pfam10369 | 75 | pfam10369, ALS_ss_C, Small subunit of acetolactate | 2e-30 | |
| cd04878 | 72 | cd04878, ACT_AHAS, N-terminal ACT domain of the Es | 3e-28 | |
| pfam10369 | 75 | pfam10369, ALS_ss_C, Small subunit of acetolactate | 5e-28 | |
| cd04878 | 72 | cd04878, ACT_AHAS, N-terminal ACT domain of the Es | 1e-27 | |
| pfam13710 | 63 | pfam13710, ACT_5, ACT domain | 2e-13 | |
| PRK06737 | 76 | PRK06737, PRK06737, acetolactate synthase 1 regula | 8e-11 | |
| pfam13710 | 63 | pfam13710, ACT_5, ACT domain | 3e-10 | |
| pfam01842 | 66 | pfam01842, ACT, ACT domain | 1e-07 | |
| PRK06737 | 76 | PRK06737, PRK06737, acetolactate synthase 1 regula | 7e-07 | |
| pfam01842 | 66 | pfam01842, ACT, ACT domain | 1e-06 | |
| PRK08178 | 96 | PRK08178, PRK08178, acetolactate synthase 1 regula | 3e-06 | |
| cd02116 | 60 | cd02116, ACT, ACT domains are commonly involved in | 5e-05 | |
| cd02116 | 60 | cd02116, ACT, ACT domains are commonly involved in | 7e-05 | |
| cd04876 | 71 | cd04876, ACT_RelA-SpoT, ACT domain found C-termina | 7e-05 | |
| PRK08178 | 96 | PRK08178, PRK08178, acetolactate synthase 1 regula | 1e-04 | |
| PRK13562 | 84 | PRK13562, PRK13562, acetolactate synthase 1 regula | 1e-04 | |
| pfam13291 | 77 | pfam13291, ACT_4, ACT domain | 4e-04 | |
| cd04879 | 71 | cd04879, ACT_3PGDH-like, ACT_3PGDH-like CD include | 5e-04 | |
| cd04879 | 71 | cd04879, ACT_3PGDH-like, ACT_3PGDH-like CD include | 0.003 | |
| PRK13562 | 84 | PRK13562, PRK13562, acetolactate synthase 1 regula | 0.004 |
| >gnl|CDD|214364 CHL00100, ilvH, acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
Score = 224 bits (574), Expect = 2e-71
Identities = 95/167 (56%), Positives = 135/167 (80%)
Query: 345 HTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQ 404
HTLS+LV D GVL + G+FARRG+NI+SLAVG AE +G+SRIT VVP D +I +L +
Sbjct: 3 HTLSVLVEDESGVLTRIAGLFARRGFNIESLAVGPAEQKGISRITMVVPGDDRTIEQLTK 62
Query: 405 QLYKLIDLHEVRDLTHLPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHTITL 464
QLYKL+++ +V+D+T++P ERELMLIK+ VN+ R ++L+IA IFRAK VD+S+ ++ L
Sbjct: 63 QLYKLVNILKVQDITNIPCVERELMLIKINVNSQTRPEILEIAQIFRAKVVDLSEESLIL 122
Query: 465 ELTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGVDSKYLRGYS 511
E+TGD K+VA+++LLE +GI E+ARTG++AL+RES V+++YLR S
Sbjct: 123 EVTGDPGKIVAIEQLLEKFGIIEIARTGKIALIRESKVNTEYLRYIS 169
|
Length = 174 |
| >gnl|CDD|183365 PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183365 PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|214364 CHL00100, ilvH, acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223517 COG0440, IlvH, Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|129225 TIGR00119, acolac_sm, acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223517 COG0440, IlvH, Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|129225 TIGR00119, acolac_sm, acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >gnl|CDD|204463 pfam10369, ALS_ss_C, Small subunit of acetolactate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|153150 cd04878, ACT_AHAS, N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >gnl|CDD|204463 pfam10369, ALS_ss_C, Small subunit of acetolactate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|153150 cd04878, ACT_AHAS, N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >gnl|CDD|222334 pfam13710, ACT_5, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|180675 PRK06737, PRK06737, acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222334 pfam13710, ACT_5, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|190133 pfam01842, ACT, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|180675 PRK06737, PRK06737, acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|190133 pfam01842, ACT, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|236174 PRK08178, PRK08178, acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|153148 cd04876, ACT_RelA-SpoT, ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >gnl|CDD|236174 PRK08178, PRK08178, acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184144 PRK13562, PRK13562, acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222030 pfam13291, ACT_4, ACT domain | Back alignment and domain information |
|---|
| >gnl|CDD|153151 cd04879, ACT_3PGDH-like, ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >gnl|CDD|153151 cd04879, ACT_3PGDH-like, ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >gnl|CDD|184144 PRK13562, PRK13562, acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 514 | |||
| KOG2663 | 309 | consensus Acetolactate synthase, small subunit [Am | 100.0 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 100.0 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 100.0 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 100.0 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 100.0 | |
| PRK11895 | 161 | ilvH acetolactate synthase 3 regulatory subunit; R | 100.0 | |
| TIGR00119 | 157 | acolac_sm acetolactate synthase, small subunit. ac | 100.0 | |
| COG0440 | 163 | IlvH Acetolactate synthase, small (regulatory) sub | 100.0 | |
| CHL00100 | 174 | ilvH acetohydroxyacid synthase small subunit | 100.0 | |
| KOG2663 | 309 | consensus Acetolactate synthase, small subunit [Am | 100.0 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 99.97 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 99.97 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 99.97 | |
| PRK08178 | 96 | acetolactate synthase 1 regulatory subunit; Review | 99.95 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 99.95 | |
| PRK13562 | 84 | acetolactate synthase 1 regulatory subunit; Provis | 99.95 | |
| PRK06737 | 76 | acetolactate synthase 1 regulatory subunit; Valida | 99.94 | |
| PF10369 | 75 | ALS_ss_C: Small subunit of acetolactate synthase; | 99.92 | |
| PRK11152 | 76 | ilvM acetolactate synthase 2 regulatory subunit; P | 99.92 | |
| PF10369 | 75 | ALS_ss_C: Small subunit of acetolactate synthase; | 99.9 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 99.88 | |
| PF13710 | 63 | ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. | 99.82 | |
| COG3978 | 86 | Acetolactate synthase (isozyme II), small (regulat | 98.99 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 98.81 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.8 | |
| PF01842 | 66 | ACT: ACT domain; InterPro: IPR002912 The ACT domai | 98.73 | |
| COG3978 | 86 | Acetolactate synthase (isozyme II), small (regulat | 98.66 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 98.62 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 98.61 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 98.59 | |
| cd04878 | 72 | ACT_AHAS N-terminal ACT domain of the Escherichia | 98.55 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 98.51 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 98.48 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 98.43 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 98.4 | |
| cd04908 | 66 | ACT_Bt0572_1 N-terminal ACT domain of a novel prot | 98.39 | |
| PF13291 | 80 | ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. | 98.36 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 98.33 | |
| cd04879 | 71 | ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te | 98.32 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 98.28 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 98.27 | |
| cd04881 | 79 | ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin | 98.26 | |
| cd04903 | 71 | ACT_LSD C-terminal ACT domain of the L-serine dehy | 98.22 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 98.21 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 98.18 | |
| cd04901 | 69 | ACT_3PGDH C-terminal ACT (regulatory) domain of D- | 98.14 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 98.12 | |
| cd04874 | 72 | ACT_Af1403 N-terminal ACT domain of the yet unchar | 98.1 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 98.1 | |
| cd04888 | 76 | ACT_PheB-BS C-terminal ACT domain of a small (~147 | 98.07 | |
| PRK08577 | 136 | hypothetical protein; Provisional | 98.06 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 98.06 | |
| PRK00194 | 90 | hypothetical protein; Validated | 98.06 | |
| cd04902 | 73 | ACT_3PGDH-xct C-terminal ACT (regulatory) domain o | 98.0 | |
| PRK00194 | 90 | hypothetical protein; Validated | 97.99 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 97.99 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 97.97 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 97.93 | |
| cd04889 | 56 | ACT_PDH-BS-like C-terminal ACT domain of the monof | 97.92 | |
| cd04877 | 74 | ACT_TyrR N-terminal ACT domain of the TyrR protein | 97.9 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 97.89 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 97.89 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.86 | |
| cd04876 | 71 | ACT_RelA-SpoT ACT domain found C-terminal of the R | 97.84 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 97.84 | |
| cd04887 | 74 | ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te | 97.83 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 97.82 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 97.8 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 97.77 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 97.74 | |
| cd04909 | 69 | ACT_PDH-BS C-terminal ACT domain of the monofuncti | 97.73 | |
| cd04905 | 80 | ACT_CM-PDT C-terminal ACT domain of the bifunction | 97.73 | |
| cd04872 | 88 | ACT_1ZPV ACT domain proteins similar to the yet un | 97.71 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 97.7 | |
| PRK04435 | 147 | hypothetical protein; Provisional | 97.69 | |
| cd04880 | 75 | ACT_AAAH-PDT-like ACT domain of the nonheme iron-d | 97.64 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 97.63 | |
| cd04883 | 72 | ACT_AcuB C-terminal ACT domain of the Bacillus sub | 97.62 | |
| cd04869 | 81 | ACT_GcvR_2 ACT domains that comprise the Glycine C | 97.57 | |
| cd04884 | 72 | ACT_CBS C-terminal ACT domain of the cystathionine | 97.57 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 97.53 | |
| cd04886 | 73 | ACT_ThrD-II-like C-terminal ACT domain of biodegra | 97.51 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 97.48 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 97.48 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 97.46 | |
| cd02116 | 60 | ACT ACT domains are commonly involved in specifica | 97.42 | |
| cd04882 | 65 | ACT_Bt0572_2 C-terminal ACT domain of a novel prot | 97.41 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 97.37 | |
| cd04875 | 74 | ACT_F4HF-DF N-terminal ACT domain of formyltetrahy | 97.35 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 97.34 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 97.33 | |
| cd04873 | 70 | ACT_UUR-ACR-like ACT domains of the bacterial sign | 97.33 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 97.32 | |
| cd04870 | 75 | ACT_PSP_1 CT domains found N-terminal of phosphose | 97.29 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 97.24 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 97.21 | |
| COG4492 | 150 | PheB ACT domain-containing protein [General functi | 97.21 | |
| COG4492 | 150 | PheB ACT domain-containing protein [General functi | 97.2 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 97.18 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 97.15 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 97.14 | |
| PF13740 | 76 | ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. | 97.1 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 97.06 | |
| cd04899 | 70 | ACT_ACR-UUR-like_2 C-terminal ACT domains of the b | 97.03 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 97.02 | |
| cd04926 | 72 | ACT_ACR_4 C-terminal ACT domain, of a novel type o | 97.0 | |
| cd04900 | 73 | ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, | 96.99 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 96.98 | |
| cd04925 | 74 | ACT_ACR_2 ACT domain-containing protein which is c | 96.96 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 96.93 | |
| cd04904 | 74 | ACT_AAAH ACT domain of the nonheme iron-dependent, | 96.91 | |
| COG4747 | 142 | ACT domain-containing protein [General function pr | 96.9 | |
| PRK11092 | 702 | bifunctional (p)ppGpp synthetase II/ guanosine-3', | 96.75 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 96.72 | |
| cd04893 | 77 | ACT_GcvR_1 ACT domains that comprise the Glycine C | 96.71 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 96.69 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 96.67 | |
| cd04927 | 76 | ACT_ACR-like_2 Second ACT domain, of a novel type | 96.67 | |
| PRK13011 | 286 | formyltetrahydrofolate deformylase; Reviewed | 96.66 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 96.59 | |
| PRK11589 | 190 | gcvR glycine cleavage system transcriptional repre | 96.57 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 96.56 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 96.54 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 96.51 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 96.47 | |
| cd04930 | 115 | ACT_TH ACT domain of the nonheme iron-dependent ar | 96.42 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 96.37 | |
| cd04931 | 90 | ACT_PAH ACT domain of the nonheme iron-dependent a | 96.29 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 96.25 | |
| PRK06027 | 286 | purU formyltetrahydrofolate deformylase; Reviewed | 96.25 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 96.24 | |
| TIGR00691 | 683 | spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( | 96.22 | |
| cd04928 | 68 | ACT_TyrKc Uncharacterized, N-terminal ACT domain o | 96.21 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 96.05 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 96.04 | |
| cd04895 | 72 | ACT_ACR_1 ACT domain-containing protein which is c | 96.04 | |
| COG1707 | 218 | ACT domain-containing protein [General function pr | 96.03 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 96.03 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 95.92 | |
| COG0317 | 701 | SpoT Guanosine polyphosphate pyrophosphohydrolases | 95.91 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 95.9 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 95.89 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 95.87 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 95.86 | |
| cd04929 | 74 | ACT_TPH ACT domain of the nonheme iron-dependent a | 95.82 | |
| COG2150 | 167 | Predicted regulator of amino acid metabolism, cont | 95.81 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 95.71 | |
| PRK10872 | 743 | relA (p)ppGpp synthetase I/GTP pyrophosphokinase; | 95.68 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 95.63 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 95.57 | |
| PRK07431 | 587 | aspartate kinase; Provisional | 95.33 | |
| PRK11899 | 279 | prephenate dehydratase; Provisional | 95.32 | |
| TIGR00719 | 208 | sda_beta L-serine dehydratase, iron-sulfur-depende | 95.31 | |
| cd04896 | 75 | ACT_ACR-like_3 ACT domain-containing protein which | 95.21 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 95.19 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 95.12 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 95.01 | |
| COG2716 | 176 | GcvR Glycine cleavage system regulatory protein [A | 95.0 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 94.97 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 94.97 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 94.95 | |
| PRK13010 | 289 | purU formyltetrahydrofolate deformylase; Reviewed | 94.94 | |
| cd04897 | 75 | ACT_ACR_3 ACT domain-containing protein which is c | 94.94 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 94.87 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 94.82 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 94.7 | |
| COG2061 | 170 | ACT-domain-containing protein, predicted allosteri | 94.69 | |
| cd04935 | 75 | ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK | 94.52 | |
| cd04891 | 61 | ACT_AK-LysC-DapG-like_1 ACT domains of the lysine- | 94.5 | |
| TIGR00655 | 280 | PurU formyltetrahydrofolate deformylase. This mode | 94.44 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 94.42 | |
| cd04913 | 75 | ACT_AKii-LysC-BS-like_1 ACT domains of the lysine- | 94.34 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 94.33 | |
| COG0077 | 279 | PheA Prephenate dehydratase [Amino acid transport | 94.32 | |
| cd04885 | 68 | ACT_ThrD-I Tandem C-terminal ACT domains of threon | 94.25 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 94.2 | |
| cd04935 | 75 | ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK | 94.2 | |
| cd04891 | 61 | ACT_AK-LysC-DapG-like_1 ACT domains of the lysine- | 94.12 | |
| cd04912 | 75 | ACT_AKiii-LysC-EC-like_1 ACT domains located C-ter | 94.1 | |
| cd04913 | 75 | ACT_AKii-LysC-BS-like_1 ACT domains of the lysine- | 94.06 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 94.0 | |
| COG0077 | 279 | PheA Prephenate dehydratase [Amino acid transport | 93.97 | |
| TIGR01270 | 464 | Trp_5_monoox tryptophan 5-monooxygenase, tetrameri | 93.85 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 93.68 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 93.6 | |
| PRK12483 | 521 | threonine dehydratase; Reviewed | 93.48 | |
| cd04871 | 84 | ACT_PSP_2 ACT domains found N-terminal of phosphos | 93.44 | |
| cd04932 | 75 | ACT_AKiii-LysC-EC_1 ACT domains located C-terminal | 93.4 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 93.35 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 93.32 | |
| PRK10622 | 386 | pheA bifunctional chorismate mutase/prephenate deh | 93.25 | |
| PRK11898 | 283 | prephenate dehydratase; Provisional | 93.11 | |
| PRK10622 | 386 | pheA bifunctional chorismate mutase/prephenate deh | 93.11 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 92.91 | |
| PRK12483 | 521 | threonine dehydratase; Reviewed | 92.91 | |
| COG2150 | 167 | Predicted regulator of amino acid metabolism, cont | 92.85 | |
| cd04906 | 85 | ACT_ThrD-I_1 First of two tandem C-terminal ACT do | 92.83 | |
| PRK11898 | 283 | prephenate dehydratase; Provisional | 92.61 | |
| cd04934 | 73 | ACT_AK-Hom3_1 CT domains located C-terminal to the | 92.56 | |
| PLN02550 | 591 | threonine dehydratase | 92.23 | |
| cd04932 | 75 | ACT_AKiii-LysC-EC_1 ACT domains located C-terminal | 92.21 | |
| cd04919 | 66 | ACT_AK-Hom3_2 ACT domains located C-terminal to th | 92.03 | |
| cd04936 | 63 | ACT_AKii-LysC-BS-like_2 ACT domains of the lysine- | 92.0 | |
| cd04912 | 75 | ACT_AKiii-LysC-EC-like_1 ACT domains located C-ter | 91.99 | |
| PLN02317 | 382 | arogenate dehydratase | 91.97 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 91.9 | |
| cd04890 | 62 | ACT_AK-like_1 ACT domains found C-terminal to the | 91.68 | |
| cd04890 | 62 | ACT_AK-like_1 ACT domains found C-terminal to the | 91.68 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 91.66 | |
| PRK03059 | 856 | PII uridylyl-transferase; Provisional | 91.6 | |
| PRK15385 | 225 | magnesium transport protein MgtC; Provisional | 91.46 | |
| TIGR00656 | 401 | asp_kin_monofn aspartate kinase, monofunctional cl | 91.43 | |
| cd04934 | 73 | ACT_AK-Hom3_1 CT domains located C-terminal to the | 91.34 | |
| PRK05092 | 931 | PII uridylyl-transferase; Provisional | 91.27 | |
| cd04922 | 66 | ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona | 91.14 | |
| PRK06635 | 404 | aspartate kinase; Reviewed | 91.0 | |
| TIGR01268 | 436 | Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetra | 91.0 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 90.94 | |
| cd04924 | 66 | ACT_AK-Arch_2 ACT domains of a monofunctional aspa | 90.56 | |
| TIGR01270 | 464 | Trp_5_monoox tryptophan 5-monooxygenase, tetrameri | 90.18 | |
| cd04916 | 66 | ACT_AKiii-YclM-BS_2 ACT domains located C-terminal | 90.16 | |
| cd04933 | 78 | ACT_AK1-AT_1 ACT domains located C-terminal to the | 90.01 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 89.98 | |
| PRK03381 | 774 | PII uridylyl-transferase; Provisional | 89.77 | |
| PLN02550 | 591 | threonine dehydratase | 89.73 | |
| PLN02317 | 382 | arogenate dehydratase | 89.58 | |
| TIGR01693 | 850 | UTase_glnD [Protein-PII] uridylyltransferase. This | 89.55 | |
| TIGR01268 | 436 | Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetra | 89.55 | |
| PRK02047 | 91 | hypothetical protein; Provisional | 89.33 | |
| cd04892 | 65 | ACT_AK-like_2 ACT domains C-terminal to the cataly | 88.99 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 88.82 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 88.7 | |
| COG2061 | 170 | ACT-domain-containing protein, predicted allosteri | 88.29 | |
| PRK15385 | 225 | magnesium transport protein MgtC; Provisional | 88.25 | |
| cd04918 | 65 | ACT_AK1-AT_2 ACT domains located C-terminal to the | 88.24 | |
| cd04933 | 78 | ACT_AK1-AT_1 ACT domains located C-terminal to the | 88.01 | |
| cd04919 | 66 | ACT_AK-Hom3_2 ACT domains located C-terminal to th | 87.96 | |
| cd04892 | 65 | ACT_AK-like_2 ACT domains C-terminal to the cataly | 87.81 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 87.65 | |
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 87.63 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 87.26 | |
| PRK08210 | 403 | aspartate kinase I; Reviewed | 86.91 | |
| cd04922 | 66 | ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona | 86.72 | |
| PRK08639 | 420 | threonine dehydratase; Validated | 86.59 | |
| PRK08526 | 403 | threonine dehydratase; Provisional | 86.12 | |
| cd04914 | 67 | ACT_AKi-DapG-BS_1 ACT domains of the diaminopimela | 86.02 | |
| PRK09084 | 448 | aspartate kinase III; Validated | 85.92 | |
| PRK05007 | 884 | PII uridylyl-transferase; Provisional | 85.78 | |
| COG3830 | 90 | ACT domain-containing protein [Signal transduction | 85.73 | |
| PRK00275 | 895 | glnD PII uridylyl-transferase; Provisional | 85.67 | |
| PF04350 | 144 | PilO: Pilus assembly protein, PilO; PDB: 2RJZ_B. | 85.66 | |
| TIGR02079 | 409 | THD1 threonine dehydratase. This model represents | 85.21 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 85.09 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 84.8 | |
| cd04924 | 66 | ACT_AK-Arch_2 ACT domains of a monofunctional aspa | 84.72 | |
| cd04923 | 63 | ACT_AK-LysC-DapG-like_2 ACT domains of the lysine- | 84.72 | |
| PRK04998 | 88 | hypothetical protein; Provisional | 84.6 | |
| cd04936 | 63 | ACT_AKii-LysC-BS-like_2 ACT domains of the lysine- | 84.37 | |
| COG0788 | 287 | PurU Formyltetrahydrofolate hydrolase [Nucleotide | 84.2 | |
| PLN02551 | 521 | aspartokinase | 84.12 | |
| PRK04374 | 869 | PII uridylyl-transferase; Provisional | 84.07 | |
| PRK08961 | 861 | bifunctional aspartate kinase/diaminopimelate deca | 83.79 | |
| cd04916 | 66 | ACT_AKiii-YclM-BS_2 ACT domains located C-terminal | 83.72 | |
| cd04915 | 66 | ACT_AK-Ectoine_2 ACT domains located C-terminal to | 83.42 | |
| PRK00907 | 92 | hypothetical protein; Provisional | 83.32 | |
| cd04937 | 64 | ACT_AKi-DapG-BS_2 ACT domains of the diaminopimela | 83.09 | |
| PRK14434 | 92 | acylphosphatase; Provisional | 83.01 | |
| cd04911 | 76 | ACT_AKiii-YclM-BS_1 ACT domains located C-terminal | 82.9 | |
| PF13840 | 65 | ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 | 82.26 | |
| PRK01759 | 854 | glnD PII uridylyl-transferase; Provisional | 82.16 | |
| PRK09034 | 454 | aspartate kinase; Reviewed | 81.72 | |
| cd04921 | 80 | ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunc | 81.67 | |
| cd04868 | 60 | ACT_AK-like ACT domains C-terminal to the catalyti | 81.46 | |
| PF09383 | 76 | NIL: NIL domain; InterPro: IPR018449 This domain i | 80.93 | |
| PRK09977 | 215 | putative Mg(2+) transport ATPase; Provisional | 80.88 | |
| TIGR00657 | 441 | asp_kinases aspartate kinase. The Lys-sensitive en | 80.6 | |
| PRK06291 | 465 | aspartate kinase; Provisional | 80.51 | |
| COG0527 | 447 | LysC Aspartokinases [Amino acid transport and meta | 80.42 | |
| TIGR01124 | 499 | ilvA_2Cterm threonine ammonia-lyase, biosynthetic, | 80.1 |
| >KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-59 Score=459.60 Aligned_cols=290 Identities=46% Similarity=0.615 Sum_probs=256.8
Q ss_pred eccCCCCCCCcceEEEEEeccccccccccccceeeccCCc--------ccccCccccccccccCCCCCCCCCcccceEEE
Q 047033 31 LKPCSDSLPNLGFSISVSFSPSVSSSLSKSNKIFLHSEPK--------KLAVSARSADENITEGTFTSRSTNRTNVRRHT 102 (514)
Q Consensus 31 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~ 102 (514)
.+.|++++ .++.||+|.| +.|.-+--.+|+..+ ...|.+++|+++|.++||.++.++ .++|+
T Consensus 10 ~rr~~~ss------~~~~~~~sts-~ts~i~yk~~h~~~~rp~~~~~~~p~~~~d~avS~ii~~tP~~~~qr---~krHv 79 (309)
T KOG2663|consen 10 HRRCVASS------CRTMFPASTS-STSAIAYKQMHRHGTRPRLPTLDTPSANADSAVSSIISETPAPSRQR---VKRHV 79 (309)
T ss_pred HHHHHhhc------cceeeeccCc-ccchhhHHHHHhcCCCCCCceecCccccchHHHHHHhhcCCcccccc---cccee
Confidence 34555554 6889999988 666433334664322 235679999999999999998877 49999
Q ss_pred EEEEEeCchhHHHHHHHHHhccCceeeeEEeeecCCCc--EEEEEEecChHHHHHHHHHHhcCcceeeEeecCChhhHHh
Q 047033 103 ISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKA--LFTIVVYGTDKVLQQVMEQLQKLVNVLKVEDLSNEPQVER 180 (514)
Q Consensus 103 IsvlVeN~pGVLsRIaglFsRRgyNIeSLtVg~Ted~~--~~TIVv~gde~~ieQI~kQLeKLvdVikV~dlt~~~~V~R 180 (514)
|+|+|+|+|||||||+|+|++||||||||.||.||+++ +||||+.|+|+.++|.++||+||++|++|+||+++++|+|
T Consensus 80 inclVqnEpGvlsRisGvlAaRGfNIdSLvVc~tevk~LsrmTIVl~Gtd~VveQa~rQiedlVnV~aVlDyt~e~~VeR 159 (309)
T KOG2663|consen 80 INCLVQNEPGVLSRISGVLAARGFNIDSLVVCLTEVKALSRMTIVLQGTDGVVEQARRQIEDLVNVYAVLDYTNEPIVER 159 (309)
T ss_pred EEEEecCCchHHHHHHHHHHhccCCchheeeechhhhhhhhceEEEeccHHHHHHHHHHHHHhhhhheeeecCCChHHHH
Confidence 99999999999999999999999999999999999997 4899999999999999999999999999999999999999
Q ss_pred heeeEEEecCccccccccccccccchhhHHHHHHhcCCEEEEecCCEEEEEEeCChhHHHHHHHHhccCCcEEEeeccce
Q 047033 181 ELMLIKVNADPKFRAEIFLFPCLGVHLQIRWLVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKI 260 (514)
Q Consensus 181 EL~LiKV~~~~~~r~EI~~~~~~~~~~~i~~l~~~F~akVVDvs~~s~~iEvTG~~~kIdafi~~L~~fGIlEvaRTG~i 260 (514)
||||+||+ + ++.+.|+| ||+.+.+.++|+|||++ ++...|++|+|-|++|||.
T Consensus 160 ELmlakvs--------l-------------lg~d~Fra--vd~~eh~~t~e~tadsg---al~tnlkkkq~~e~v~tak- 212 (309)
T KOG2663|consen 160 ELMLAKVS--------L-------------LGVDYFRA--VDLHEHTLTIEVTADSG---ALVTNLKKKQIHEIVRTAK- 212 (309)
T ss_pred HHHHHHHH--------h-------------hhHHHHHh--hhhhhhhhhhhhccCch---HHHhhHHHhccchhhccHH-
Confidence 99999996 3 78999999 99999999999999999 7889999999999999999
Q ss_pred eeecccccCCCccccccccCCCCCCCCCccccccccccccccCCCCCCCCceEecCCCCCCcccccccCCcccccCCCcc
Q 047033 261 ALRREKLGASAPFWRFSAASYPDLNETPTIDGLVGAGHRPLLSETDTVEGDVYPVEPSDGLTVNQVLDPHWGVLNDDDTS 340 (514)
Q Consensus 261 Al~R~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~gdvy~v~~~~~~~~~~~~~~~~~~~~~~~~~ 340 (514)
|+.|.+++..++||+|++++||++.+..+.+.+.... ..+|||||++|..++. | +++++.+
T Consensus 213 allrlk~~~la~i~rlta~f~grvvdis~~s~i~elt---------a~p~rV~~fl~l~dp~---------g-vle~~rS 273 (309)
T KOG2663|consen 213 ALLRLKMGHLAPIWRLTAAFYGRVVDISETSCIVELT---------AKPGRVYPFLPLVDPK---------G-VLEEDRS 273 (309)
T ss_pred HHHHHhhhccchHHHHhhhhccchhccccceeeeeec---------cCCCcccccccccCcc---------c-chhhccc
Confidence 8999999999999999999999999887777755433 5799999999977542 2 6689999
Q ss_pred cceeEEEEEEEeCcchHHHHHHHHhhccCceeeeEeeeecCCCCeeEEEEEEeC
Q 047033 341 GLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPA 394 (514)
Q Consensus 341 ~~~khtLSIlVeN~pGVL~RItgLFsRRGyNIeSLtVg~Te~~~iSRiTIVV~g 394 (514)
|++.||++.++.|-| ++++|+.|.++++|||.+.+|
T Consensus 274 Gl~a~trspl~n~v~------------------e~A~~dae~eei~rIttlpPg 309 (309)
T KOG2663|consen 274 GLRAHTRSPLVNSVP------------------ELAVGDAEIEEISRITTLPPG 309 (309)
T ss_pred chhhcccccccccCh------------------hhccCchhhhhheeccccCCC
Confidence 999999999999998 899999999999999988765
|
|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00119 acolac_sm acetolactate synthase, small subunit | Back alignment and domain information |
|---|
| >COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >CHL00100 ilvH acetohydroxyacid synthase small subunit | Back alignment and domain information |
|---|
| >KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13562 acetolactate synthase 1 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06737 acetolactate synthase 1 regulatory subunit; Validated | Back alignment and domain information |
|---|
| >PF10369 ALS_ss_C: Small subunit of acetolactate synthase; InterPro: IPR019455 This entry represents the C-terminal domain of the small subunit of acetolactate synthase (the N-terminal domain being an ACT domain) | Back alignment and domain information |
|---|
| >PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PF10369 ALS_ss_C: Small subunit of acetolactate synthase; InterPro: IPR019455 This entry represents the C-terminal domain of the small subunit of acetolactate synthase (the N-terminal domain being an ACT domain) | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B | Back alignment and domain information |
|---|
| >COG3978 Acetolactate synthase (isozyme II), small (regulatory) subunit [Function unknown] | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold | Back alignment and domain information |
|---|
| >COG3978 Acetolactate synthase (isozyme II), small (regulatory) subunit [Function unknown] | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains | Back alignment and domain information |
|---|
| >PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains | Back alignment and domain information |
|---|
| >cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a | Back alignment and domain information |
|---|
| >PRK08577 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) | Back alignment and domain information |
|---|
| >PRK00194 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate | Back alignment and domain information |
|---|
| >cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) | Back alignment and domain information |
|---|
| >cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme | Back alignment and domain information |
|---|
| >cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04435 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB | Back alignment and domain information |
|---|
| >cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme | Back alignment and domain information |
|---|
| >cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >COG4492 PheB ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4492 PheB ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) | Back alignment and domain information |
|---|
| >COG4747 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK13011 formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK06027 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family | Back alignment and domain information |
|---|
| >cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >COG1707 ACT domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes | Back alignment and domain information |
|---|
| >COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07431 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11899 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit | Back alignment and domain information |
|---|
| >cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13010 purU formyltetrahydrofolate deformylase; Reviewed | Back alignment and domain information |
|---|
| >cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >COG2061 ACT-domain-containing protein, predicted allosteric regulator of homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein | Back alignment and domain information |
|---|
| >cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins | Back alignment and domain information |
|---|
| >TIGR00655 PurU formyltetrahydrofolate deformylase | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein | Back alignment and domain information |
|---|
| >cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins | Back alignment and domain information |
|---|
| >cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK12483 threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
| >cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) | Back alignment and domain information |
|---|
| >cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK11898 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12483 threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
| >COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) | Back alignment and domain information |
|---|
| >PRK11898 prephenate dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04934 ACT_AK-Hom3_1 CT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains | Back alignment and domain information |
|---|
| >PLN02550 threonine dehydratase | Back alignment and domain information |
|---|
| >cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 | Back alignment and domain information |
|---|
| >cd04936 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains | Back alignment and domain information |
|---|
| >cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >PLN02317 arogenate dehydratase | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04890 ACT_AK-like_1 ACT domains found C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >cd04890 ACT_AK-like_1 ACT domains found C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK03059 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK15385 magnesium transport protein MgtC; Provisional | Back alignment and domain information |
|---|
| >TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class | Back alignment and domain information |
|---|
| >cd04934 ACT_AK-Hom3_1 CT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains | Back alignment and domain information |
|---|
| >PRK05092 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >PRK06635 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01268 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetrameric form | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) | Back alignment and domain information |
|---|
| >TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric | Back alignment and domain information |
|---|
| >cd04916 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04933 ACT_AK1-AT_1 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1) | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK03381 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02550 threonine dehydratase | Back alignment and domain information |
|---|
| >PLN02317 arogenate dehydratase | Back alignment and domain information |
|---|
| >TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase | Back alignment and domain information |
|---|
| >TIGR01268 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetrameric form | Back alignment and domain information |
|---|
| >PRK02047 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04892 ACT_AK-like_2 ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG2061 ACT-domain-containing protein, predicted allosteric regulator of homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15385 magnesium transport protein MgtC; Provisional | Back alignment and domain information |
|---|
| >cd04918 ACT_AK1-AT_2 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1) | Back alignment and domain information |
|---|
| >cd04933 ACT_AK1-AT_1 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1) | Back alignment and domain information |
|---|
| >cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 | Back alignment and domain information |
|---|
| >cd04892 ACT_AK-like_2 ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >PRK08210 aspartate kinase I; Reviewed | Back alignment and domain information |
|---|
| >cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >PRK08639 threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK08526 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd04914 ACT_AKi-DapG-BS_1 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI | Back alignment and domain information |
|---|
| >PRK09084 aspartate kinase III; Validated | Back alignment and domain information |
|---|
| >PRK05007 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >COG3830 ACT domain-containing protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00275 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PF04350 PilO: Pilus assembly protein, PilO; PDB: 2RJZ_B | Back alignment and domain information |
|---|
| >TIGR02079 THD1 threonine dehydratase | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) | Back alignment and domain information |
|---|
| >cd04923 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains | Back alignment and domain information |
|---|
| >PRK04998 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04936 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains | Back alignment and domain information |
|---|
| >COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02551 aspartokinase | Back alignment and domain information |
|---|
| >PRK04374 PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional | Back alignment and domain information |
|---|
| >cd04916 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >cd04915 ACT_AK-Ectoine_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK00907 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI | Back alignment and domain information |
|---|
| >PRK14434 acylphosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04911 ACT_AKiii-YclM-BS_1 ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII | Back alignment and domain information |
|---|
| >PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D | Back alignment and domain information |
|---|
| >PRK01759 glnD PII uridylyl-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK09034 aspartate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04921 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) | Back alignment and domain information |
|---|
| >cd04868 ACT_AK-like ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) | Back alignment and domain information |
|---|
| >PF09383 NIL: NIL domain; InterPro: IPR018449 This domain is found at the C terminus of ABC transporter proteins involved in D-methionine transport as well as a number of ferredoxin-like proteins | Back alignment and domain information |
|---|
| >PRK09977 putative Mg(2+) transport ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00657 asp_kinases aspartate kinase | Back alignment and domain information |
|---|
| >PRK06291 aspartate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0527 LysC Aspartokinases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 514 | ||||
| 2fgc_A | 193 | Crystal Structure Of Acetolactate Synthase- Small S | 3e-25 | ||
| 2pc6_A | 165 | Crystal Structure Of Putative Acetolactate Synthase | 7e-25 | ||
| 2pc6_A | 165 | Crystal Structure Of Putative Acetolactate Synthase | 6e-22 | ||
| 2f1f_A | 164 | Crystal Structure Of The Regulatory Subunit Of Acet | 7e-23 | ||
| 2f1f_A | 164 | Crystal Structure Of The Regulatory Subunit Of Acet | 2e-18 | ||
| 2ko1_A | 88 | Solution Nmr Structure Of The Act Domain From Gtp P | 8e-04 |
| >pdb|2FGC|A Chain A, Crystal Structure Of Acetolactate Synthase- Small Subunit From Thermotoga Maritima Length = 193 | Back alignment and structure |
|
| >pdb|2PC6|A Chain A, Crystal Structure Of Putative Acetolactate Synthase- Small Subunit From Nitrosomonas Europaea Length = 165 | Back alignment and structure |
| >pdb|2PC6|A Chain A, Crystal Structure Of Putative Acetolactate Synthase- Small Subunit From Nitrosomonas Europaea Length = 165 | Back alignment and structure |
| >pdb|2F1F|A Chain A, Crystal Structure Of The Regulatory Subunit Of Acetohydroxyacid Synthase Isozyme Iii From E. Coli Length = 164 | Back alignment and structure |
| >pdb|2F1F|A Chain A, Crystal Structure Of The Regulatory Subunit Of Acetohydroxyacid Synthase Isozyme Iii From E. Coli Length = 164 | Back alignment and structure |
| >pdb|2KO1|A Chain A, Solution Nmr Structure Of The Act Domain From Gtp Pyrophosphokinase Of Chlorobium Tepidum. Northeast Structural Genomics Consortium Target Ctr148a Length = 88 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 514 | |||
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 8e-74 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 7e-73 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 4e-73 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 4e-72 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 9e-72 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 8e-70 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-11 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 1e-05 |
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Length = 165 | Back alignment and structure |
|---|
Score = 230 bits (588), Expect = 8e-74
Identities = 61/160 (38%), Positives = 94/160 (58%)
Query: 341 GLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESIS 400
G H +S+L+ + G L+ V G+F+ RGYNI+SL+V E LSR+T V DE +
Sbjct: 1 GHMRHIISLLMENEAGALSRVAGLFSARGYNIESLSVAPTEDPTLSRMTLVTNGPDEIVE 60
Query: 401 KLMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDH 460
++ +QL KLI++ ++ DL+ + ERELML+KV R ++ +A IFR +DV++
Sbjct: 61 QITKQLNKLIEVVKLIDLSSEGYVERELMLVKVRAVGKDREEMKRLADIFRGNIIDVTNE 120
Query: 461 TITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRES 500
T+ELTG K+ + ++ I E+ARTG L R
Sbjct: 121 LYTIELTGTRSKLDGFLQAVDCNLILEIARTGVSGLSRGE 160
|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Length = 165 | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Length = 193 | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Length = 193 | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Length = 164 | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Length = 164 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Length = 88 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 514 | |||
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 100.0 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 100.0 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 100.0 | |
| 2fgc_A | 193 | Acetolactate synthase, small subunit; regulatory s | 100.0 | |
| 2pc6_A | 165 | Probable acetolactate synthase isozyme III (small; | 100.0 | |
| 2f1f_A | 164 | Acetolactate synthase isozyme III small subunit; f | 100.0 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 99.04 | |
| 2f06_A | 144 | Conserved hypothetical protein; structural genomic | 98.86 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 98.85 | |
| 2ko1_A | 88 | CTR148A, GTP pyrophosphokinase; homodimer, alpha+b | 98.73 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 98.71 | |
| 1u8s_A | 192 | Glycine cleavage system transcriptional repressor, | 98.66 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 98.56 | |
| 1zpv_A | 91 | ACT domain protein; structural genomics, PSI, prot | 98.45 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 98.01 | |
| 1y7p_A | 223 | Hypothetical protein AF1403; structural genomics, | 97.73 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 97.21 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 97.05 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 97.01 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 96.97 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 96.9 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 96.87 | |
| 2nyi_A | 195 | Unknown protein; protein structure initiative, PSI | 96.87 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 96.86 | |
| 3l76_A | 600 | Aspartokinase; allostery, ACT domains, kinase tran | 96.63 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 96.48 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 96.46 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 96.46 | |
| 3o1l_A | 302 | Formyltetrahydrofolate deformylase; structural gen | 96.42 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 96.35 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 96.35 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 96.33 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 96.3 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 96.27 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 96.2 | |
| 3obi_A | 288 | Formyltetrahydrofolate deformylase; structural gen | 96.18 | |
| 3lou_A | 292 | Formyltetrahydrofolate deformylase; structural gen | 96.17 | |
| 3n0v_A | 286 | Formyltetrahydrofolate deformylase; formyl transfe | 96.06 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 95.94 | |
| 3nrb_A | 287 | Formyltetrahydrofolate deformylase; N-terminal ACT | 95.85 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 95.77 | |
| 2re1_A | 167 | Aspartokinase, alpha and beta subunits; structural | 95.66 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 95.63 | |
| 2qmx_A | 283 | Prephenate dehydratase; APC86053, L-Phe inhibition | 95.24 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 94.82 | |
| 2qmx_A | 283 | Prephenate dehydratase; APC86053, L-Phe inhibition | 94.73 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 94.33 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 94.2 | |
| 3mwb_A | 313 | Prephenate dehydratase; L-Phe, PSI, MCSG, structur | 94.13 | |
| 3mwb_A | 313 | Prephenate dehydratase; L-Phe, PSI, MCSG, structur | 93.84 | |
| 2qmw_A | 267 | PDT, prephenate dehydratase; APC85812, prephenate | 93.6 | |
| 2dt9_A | 167 | Aspartokinase; protein-ligand complex, regulatory | 93.35 | |
| 3mah_A | 157 | Aspartokinase; aspartate kinase, structural genomi | 93.28 | |
| 2qmw_A | 267 | PDT, prephenate dehydratase; APC85812, prephenate | 92.51 | |
| 3luy_A | 329 | Probable chorismate mutase; structural genomics, A | 92.21 | |
| 1phz_A | 429 | Protein (phenylalanine hydroxylase); aromatic amin | 91.78 | |
| 3mah_A | 157 | Aspartokinase; aspartate kinase, structural genomi | 91.43 | |
| 2dtj_A | 178 | Aspartokinase; protein-ligand complex, regulatory | 91.41 | |
| 3luy_A | 329 | Probable chorismate mutase; structural genomics, A | 91.27 | |
| 1phz_A | 429 | Protein (phenylalanine hydroxylase); aromatic amin | 90.76 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 90.28 | |
| 3s1t_A | 181 | Aspartokinase; ACT domain, threonine binding, regu | 90.07 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 89.45 | |
| 2nzc_A | 86 | Hypothetical protein; sturctural genomics, TM1266, | 89.33 | |
| 1rwu_A | 109 | Hypothetical UPF0250 protein YBED; mixed alpha-bet | 88.08 | |
| 4go7_X | 200 | Aspartokinase; transferase; 2.00A {Mycobacterium t | 87.92 | |
| 3ab4_A | 421 | Aspartokinase; aspartate kinase, concerted inhibit | 86.53 | |
| 2h9z_A | 86 | Hypothetical protein HP0495; feredoxin-like (beta- | 86.0 | |
| 3ced_A | 98 | Methionine import ATP-binding protein METN 2; ABC | 84.1 | |
| 2qrr_A | 101 | Methionine import ATP-binding protein METN; alpha- | 83.58 | |
| 2nzc_A | 86 | Hypothetical protein; sturctural genomics, TM1266, | 83.12 | |
| 2qrr_A | 101 | Methionine import ATP-binding protein METN; alpha- | 82.71 |
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
Probab=100.00 E-value=4.5e-55 Score=416.07 Aligned_cols=170 Identities=38% Similarity=0.602 Sum_probs=156.6
Q ss_pred cCCcccccCCCcccceeEEEEEEEeCcchHHHHHHHHhhccCceeeeEeeeecCCCCeeEEEEEEeCChHHHHHHHHHHh
Q 047033 328 DPHWGVLNDDDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLY 407 (514)
Q Consensus 328 ~~~~~~~~~~~~~~~~khtLSIlVeN~pGVL~RItgLFsRRGyNIeSLtVg~Te~~~iSRiTIVV~gde~~ieQI~kQL~ 407 (514)
|+|||-+.+. +|+|+|+++|+|+||+|+||+++|+||||||+||+++++++++++||||+|+|+++.++||.|||+
T Consensus 17 ~~~~~~m~~~----~m~~~LsVlVeN~pGvLaRItglfsrRG~NI~SLtV~~ted~gisRitIvV~g~e~~ieqL~kQL~ 92 (193)
T 2fgc_A 17 LYFQGHMTDQ----IREHLVSMLVHNKPGVMRKVANLFARRGFNISSITVGESETPGLSRLVIMVKGDDKTIEQIEKQAY 92 (193)
T ss_dssp --------------CEEEEEEEEEECCTTHHHHHHHHHHTTTCEEEEEEEEECSSTTEEEEEEEEEECTTHHHHHHHHHT
T ss_pred hhhhccCCcc----ceEEEEEEEECCCChHHHHHHHHHHHCCceEEEEEeeccCCCCEEEEEEEEECCHHHHHHHHHHhc
Confidence 8999998665 579999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCccEEEEEecCC--chhhheeeEEEEEecCcccHHHHHHHHHhcCcEEEEecCCEEEEEEecCHHHHHHHHHHhccCCc
Q 047033 408 KLIDLHEVRDLTH--LPFAERELMLIKVAVNTTARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGI 485 (514)
Q Consensus 408 KLidVikV~dlt~--~~~V~REL~LIKV~~~~~~R~eI~~la~iFrakIVDvs~~si~iE~TG~~~KIdafi~lL~pyGI 485 (514)
||+||++|.|+++ .++|+||||||||++++. |.||+++|++|||+|||++++++++|+||+++||++|+++|+||||
T Consensus 93 KLidVikV~dl~~~~~~~v~REl~LiKV~~~~~-r~ei~~i~~~fra~ivDv~~~s~~iE~tG~~~ki~a~i~~l~~~gi 171 (193)
T 2fgc_A 93 KLVEVVKVTPIDPLPENRVEREMALIKVRFDED-KQEIFQLVEIFRGKIIDVSREGAIIEITGARSKVEAFINLLPQKQV 171 (193)
T ss_dssp TSTTEEEEEECCSSGGGEEEEEEEEEEEECSSC-HHHHHHHHHHTTCEEEEECSSEEEEEEEECHHHHHHHHHHSCGGGE
T ss_pred CcCceEEEEEecCCCCccceeEEEEEEEeCCcC-HHHHHHHHHHcCCEEEEEcCCEEEEEEcCCHHHHHHHHHHhhhhCC
Confidence 9999999999999 999999999999999988 9999999999999999999999999999999999999999999999
Q ss_pred EEEeecceeEeeccCCc
Q 047033 486 CEVARTGRVALVRESGV 502 (514)
Q Consensus 486 lEvaRTG~vAl~Rg~~~ 502 (514)
+|++|||++||.||++.
T Consensus 172 ~E~~RtG~val~Rg~~~ 188 (193)
T 2fgc_A 172 EEIARTGIVAMNRWNVK 188 (193)
T ss_dssp EEEEECCCEEEECCCC-
T ss_pred EEEEccChhheecCCcc
Confidence 99999999999999864
|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 | Back alignment and structure |
|---|
| >2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A | Back alignment and structure |
|---|
| >3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 | Back alignment and structure |
|---|
| >3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} | Back alignment and structure |
|---|
| >1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A | Back alignment and structure |
|---|
| >3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2; 2.31A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* | Back alignment and structure |
|---|
| >3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} | Back alignment and structure |
|---|
| >1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >2nzc_A Hypothetical protein; sturctural genomics, TM1266, structural genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.95A {Thermotoga maritima} SCOP: d.58.18.14 | Back alignment and structure |
|---|
| >1rwu_A Hypothetical UPF0250 protein YBED; mixed alpha-beta fold, structural genomics, protein structure initiative, PSI; NMR {Escherichia coli} SCOP: d.58.54.1 | Back alignment and structure |
|---|
| >4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X | Back alignment and structure |
|---|
| >3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A | Back alignment and structure |
|---|
| >2h9z_A Hypothetical protein HP0495; feredoxin-like (beta-alpha-beta-BETA-alpha-beta), structural genomics, unknown function; NMR {Helicobacter pylori} SCOP: d.58.54.2 PDB: 2joq_A | Back alignment and structure |
|---|
| >3ced_A Methionine import ATP-binding protein METN 2; ABC transporter, NIL domain, structur genomics, PSI-2, protein structure initiative; 2.15A {Staphylococcus aureus subsp} SCOP: d.58.18.13 | Back alignment and structure |
|---|
| >2qrr_A Methionine import ATP-binding protein METN; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 1.71A {Vibrio parahaemolyticus} SCOP: d.58.18.13 | Back alignment and structure |
|---|
| >2nzc_A Hypothetical protein; sturctural genomics, TM1266, structural genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.95A {Thermotoga maritima} SCOP: d.58.18.14 | Back alignment and structure |
|---|
| >2qrr_A Methionine import ATP-binding protein METN; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 1.71A {Vibrio parahaemolyticus} SCOP: d.58.18.13 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 514 | ||||
| d2fgca2 | 78 | d.58.18.6 (A:27-104) Acetolactate synthase small s | 2e-30 | |
| d2fgca2 | 78 | d.58.18.6 (A:27-104) Acetolactate synthase small s | 9e-28 | |
| d2pc6a2 | 77 | d.58.18.6 (A:1-77) Acetolactate synthase small sub | 3e-28 | |
| d2pc6a2 | 77 | d.58.18.6 (A:1-77) Acetolactate synthase small sub | 2e-27 | |
| d2f1fa1 | 76 | d.58.18.6 (A:2-77) Acetolactate synthase small sub | 8e-28 | |
| d2f1fa1 | 76 | d.58.18.6 (A:2-77) Acetolactate synthase small sub | 2e-27 | |
| d2pc6a1 | 86 | d.58.18.6 (A:78-163) Acetolactate synthase small s | 8e-26 | |
| d2pc6a1 | 86 | d.58.18.6 (A:78-163) Acetolactate synthase small s | 1e-25 | |
| d2f1fa2 | 86 | d.58.18.6 (A:78-163) Acetolactate synthase small s | 2e-25 | |
| d2f1fa2 | 86 | d.58.18.6 (A:78-163) Acetolactate synthase small s | 9e-25 | |
| d2fgca1 | 83 | d.58.18.6 (A:105-187) Acetolactate synthase small | 6e-23 | |
| d2fgca1 | 83 | d.58.18.6 (A:105-187) Acetolactate synthase small | 3e-22 | |
| d1sc6a3 | 84 | d.58.18.1 (A:327-410) Phosphoglycerate dehydrogena | 2e-15 | |
| d1sc6a3 | 84 | d.58.18.1 (A:327-410) Phosphoglycerate dehydrogena | 5e-11 | |
| d2f06a2 | 70 | d.58.18.11 (A:1-70) Hypothetical protein BT0572 {B | 2e-14 | |
| d2f06a2 | 70 | d.58.18.11 (A:1-70) Hypothetical protein BT0572 {B | 3e-14 | |
| d1ygya3 | 78 | d.58.18.1 (A:452-529) Phosphoglycerate dehydrogena | 1e-13 | |
| d1ygya3 | 78 | d.58.18.1 (A:452-529) Phosphoglycerate dehydrogena | 2e-13 | |
| d1y7pa2 | 77 | d.58.18.12 (A:2-78) Hypothetical protein AF1403, N | 4e-06 | |
| d2f06a1 | 71 | d.58.18.11 (A:71-141) Hypothetical protein BT0572 | 5e-06 | |
| d1u8sa1 | 86 | d.58.18.5 (A:2-87) putative transcriptional repres | 0.001 |
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Length = 78 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: ACT-like family: IlvH-like domain: Acetolactate synthase small subunit, IlvH species: Thermotoga maritima [TaxId: 2336]
Score = 111 bits (279), Expect = 2e-30
Identities = 34/77 (44%), Positives = 55/77 (71%)
Query: 342 LRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISK 401
+R H +SMLV++ PGV+ V +FARRG+NI S+ VG +ET GLSR+ +V D++I +
Sbjct: 1 IREHLVSMLVHNKPGVMRKVANLFARRGFNISSITVGESETPGLSRLVIMVKGDDKTIEQ 60
Query: 402 LMQQLYKLIDLHEVRDL 418
+ +Q YKL+++ +V +
Sbjct: 61 IEKQAYKLVEVVKVTPI 77
|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Length = 78 | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Length = 77 | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Length = 77 | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d2pc6a1 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Length = 86 | Back information, alignment and structure |
|---|
| >d2pc6a1 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Length = 86 | Back information, alignment and structure |
|---|
| >d2f1fa2 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Length = 86 | Back information, alignment and structure |
|---|
| >d2f1fa2 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Length = 86 | Back information, alignment and structure |
|---|
| >d2fgca1 d.58.18.6 (A:105-187) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Length = 83 | Back information, alignment and structure |
|---|
| >d2fgca1 d.58.18.6 (A:105-187) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Length = 83 | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Length = 84 | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Length = 84 | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 70 | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 70 | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 78 | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 78 | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 77 | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 71 | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Length = 86 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 514 | |||
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 99.97 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 99.97 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 99.97 | |
| d2fgca2 | 78 | Acetolactate synthase small subunit, IlvH {Thermot | 99.96 | |
| d2pc6a2 | 77 | Acetolactate synthase small subunit, IlvH {Nitroso | 99.96 | |
| d2f1fa1 | 76 | Acetolactate synthase small subunit, IlvH {Escheri | 99.95 | |
| d2pc6a1 | 86 | Acetolactate synthase small subunit, IlvH {Nitroso | 99.92 | |
| d2fgca1 | 83 | Acetolactate synthase small subunit, IlvH {Thermot | 99.91 | |
| d2f1fa2 | 86 | Acetolactate synthase small subunit, IlvH {Escheri | 99.91 | |
| d2pc6a1 | 86 | Acetolactate synthase small subunit, IlvH {Nitroso | 99.9 | |
| d2f1fa2 | 86 | Acetolactate synthase small subunit, IlvH {Escheri | 99.89 | |
| d2fgca1 | 83 | Acetolactate synthase small subunit, IlvH {Thermot | 99.89 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 99.56 | |
| d2f06a2 | 70 | Hypothetical protein BT0572 {Bacteroides thetaiota | 99.54 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 99.09 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 99.08 | |
| d1sc6a3 | 84 | Phosphoglycerate dehydrogenase, regulatory (C-term | 99.05 | |
| d1ygya3 | 78 | Phosphoglycerate dehydrogenase, regulatory (C-term | 98.97 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 98.56 | |
| d1y7pa2 | 77 | Hypothetical protein AF1403, N-terminal domain {Ar | 98.5 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.2 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 98.17 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 98.05 | |
| d1u8sa1 | 86 | putative transcriptional repressor VC2159 {Vibrio | 98.03 | |
| d1zpva1 | 83 | UPF0237 protein SP0238 {Streptococcus pneumoniae [ | 97.96 | |
| d2f06a1 | 71 | Hypothetical protein BT0572 {Bacteroides thetaiota | 97.74 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 97.52 | |
| d1u8sa2 | 93 | putative transcriptional repressor VC2159 {Vibrio | 97.42 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 96.98 | |
| d2qmwa2 | 80 | Prephenate dehydratase C-terminal domain {Staphylo | 96.73 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 96.52 | |
| d1phza1 | 97 | Phenylalanine hydroxylase N-terminal domain {Rat ( | 96.03 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 95.15 | |
| d2hmfa2 | 67 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 93.9 | |
| d2cdqa3 | 75 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 93.72 | |
| d2hmfa3 | 100 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 93.53 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 93.17 | |
| d1rwua_ | 87 | Hypothetical protein ybeD {Escherichia coli [TaxId | 93.06 | |
| d2hmfa3 | 100 | Aspartokinase {Methanococcus jannaschii [TaxId: 21 | 92.58 | |
| d2cdqa2 | 91 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 90.8 | |
| d3ceda1 | 95 | Methionine import ATP-binding protein MetN2 {Staph | 90.72 | |
| d2qswa1 | 90 | Methionine import ATP-binding protein MetN2 {Enter | 88.11 | |
| d2nzca1 | 80 | Hypothetical protein TM1266 {Thermotoga maritima [ | 87.91 | |
| d2qswa1 | 90 | Methionine import ATP-binding protein MetN2 {Enter | 87.86 | |
| d2qrra1 | 97 | Methionine import ATP-binding protein MetN {Vibrio | 87.73 | |
| d2qrra1 | 97 | Methionine import ATP-binding protein MetN {Vibrio | 87.48 | |
| d2j0wa2 | 91 | Aspartokinase {Escherichia coli [TaxId: 562]} | 87.41 | |
| d2cdqa3 | 75 | Aspartokinase {Thale cress (Arabidopsis thaliana) | 86.54 | |
| d3dhxa1 | 99 | Methionine import ATP-binding protein MetN {Escher | 85.57 | |
| d2j0wa3 | 64 | Aspartokinase {Escherichia coli [TaxId: 562]} | 85.02 | |
| d3dhxa1 | 99 | Methionine import ATP-binding protein MetN {Escher | 84.75 | |
| d3ceda1 | 95 | Methionine import ATP-binding protein MetN2 {Staph | 83.41 | |
| d2joqa1 | 86 | Hypothetical protein HP0495 {Helicobacter pylori [ | 82.69 | |
| d2j0wa2 | 91 | Aspartokinase {Escherichia coli [TaxId: 562]} | 82.13 | |
| d1gtda_ | 82 | PurS subunit of FGAM synthetase {Archaeon Methanob | 81.71 |
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: ACT-like family: IlvH-like domain: Acetolactate synthase small subunit, IlvH species: Nitrosomonas europaea [TaxId: 915]
Probab=99.97 E-value=1.6e-32 Score=225.54 Aligned_cols=77 Identities=40% Similarity=0.664 Sum_probs=75.9
Q ss_pred eeEEEEEEEeCcchHHHHHHHHhhccCceeeeEeeeecCCCCeeEEEEEEeCChHHHHHHHHHHhcCccEEEEEecC
Q 047033 343 RSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLT 419 (514)
Q Consensus 343 ~khtLSIlVeN~pGVL~RItgLFsRRGyNIeSLtVg~Te~~~iSRiTIVV~gde~~ieQI~kQL~KLidVikV~dlt 419 (514)
|||||+++|+|+||||+||+|+|+||||||+||+||+||++++||||||+.|+++.++|++|||+||+||++|.|+|
T Consensus 1 Mk~tisv~veN~pGvL~Ris~lF~rRg~NI~Sltv~~te~~~iSRmtivv~~~~~~i~qi~kQL~KlvdVi~V~dlt 77 (77)
T d2pc6a2 1 MRHIISLLMENEAGALSRVAGLFSARGYNIESLSVAPTEDPTLSRMTLVTNGPDEIVEQITKQLNKLIEVVKLIDLS 77 (77)
T ss_dssp EEEEEEEEEECSTTHHHHHHHHHHHHTCCCCEEEEEECSSTTEEEEEEEEEECHHHHHHHHHHHHHSTTEEEEEEGG
T ss_pred CcEEEEEEEECCccHHHHHHHHHhccCcceEEEEEeccCCCCeEEEEEEEECCHHHHHHHHHHHhCCcCEEEEEECc
Confidence 78999999999999999999999999999999999999999999999999999999999999999999999999986
|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pc6a1 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2fgca1 d.58.18.6 (A:105-187) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f1fa2 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pc6a1 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2f1fa2 d.58.18.6 (A:78-163) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fgca1 d.58.18.6 (A:105-187) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rwua_ d.58.54.1 (A:) Hypothetical protein ybeD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3ceda1 d.58.18.13 (A:247-341) Methionine import ATP-binding protein MetN2 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2qswa1 d.58.18.13 (A:256-345) Methionine import ATP-binding protein MetN2 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2nzca1 d.58.18.14 (A:2-81) Hypothetical protein TM1266 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qswa1 d.58.18.13 (A:256-345) Methionine import ATP-binding protein MetN2 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2qrra1 d.58.18.13 (A:2-98) Methionine import ATP-binding protein MetN {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2qrra1 d.58.18.13 (A:2-98) Methionine import ATP-binding protein MetN {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2j0wa2 d.58.18.10 (A:295-385) Aspartokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cdqa3 d.58.18.10 (A:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3dhxa1 d.58.18.13 (A:2-100) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j0wa3 d.58.18.10 (A:386-449) Aspartokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3dhxa1 d.58.18.13 (A:2-100) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3ceda1 d.58.18.13 (A:247-341) Methionine import ATP-binding protein MetN2 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2joqa1 d.58.54.2 (A:4-89) Hypothetical protein HP0495 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2j0wa2 d.58.18.10 (A:295-385) Aspartokinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gtda_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|