Citrus Sinensis ID: 047035

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780---
SFFLSISDREYADEILTSWVDDGISDCCDWERVTCDATAGQVIQLSLDFARMFDFYNSSDGFPILNFSLFLPFQELQILDLSGNYFDGWNENKDYDSSGSSKKLKILNLNYNNFNDSVLPYLNTLTSLTTLNLYYNRIGGLNPSQGLANLRNLKALNLSWNGISSGATRLGLGNLTNLEVLDLSANRISGSLTELAPFRNLKVLGMRNNLLNGSVESKGICELKNLTELDLGENNLEGQLPWCLSDLIGLKVLDISFNHLSGNLPSVIANLTSLEYLALSDNNFQGEFPLSLLTNHSNLEVLLLKVSSNLRLKTENWIPTFQLKVLQLPNCNLKVIPSFLLHQYDFKFLDLSSNKLVGNFPTWLMQNNTKLEVLRLSNNSFSGILQLPKVKHDLLRHLDISNNNLTGMLPQNMGIVIQKLMYIDISKNNFEGNIPYSIGEMKELFLLDLSRNKFSGDLSATSVIRCASLEYLDVSENNFYGHIFPTYMNLTQLRWLYLKNNHFTGKIKAGLLNSHGLVVLDISNNLLSGHIPCWIGNFSYLDVLLMSKNHLEGNIPVQINNFRQLQLLDLSENRLFGSIASSLNLSSIMHLYLQNNALSGQIPSTLFRSTELLTLDLRDNKFFGRIPDQINNHSELRVLLLRGNYLQGQIPIALCQLQKLGILDLSHNKLNGSIPSCFVNMLFWREGNGDLYGSGLYIYFQLGGLHSIGTYYNSTLDLWLFGDDYITLPQRARVQFVTKNRYEFYNGSNLNYMSGIDLSYNELTGEIPSEIGELPKVRALNLS
ccccccccccccccccccccccccccccccEEEEEccccccEEEEEcccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccCECcccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEccccCEEECccccccccccccEEEccccCCccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccCEECcccccccccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccCEECcccHHHHccccccEEccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHccccHHHHcccccccccccccccccccccEEcCCcccccccccccccccccccccEEEEccccccccccccccccccEEEcccccccccccccccccccccEEccc
SFFLSISDREYADEILTSWVDDGISDCCDWERVTCDATAGQVIQLSLDFARMFDFYNSSDGFPILNFSLFLPFQELQILDLSGNYFDGWNENKDYDSSGSSKKLKILNLNYNNFNDSVLPYLNTLTSLTTLNLYYNRIGGLNPSQGLANLRNLKALNLSWNGISSGATRLGLGNLTNLEVLDLSANRISGSLTELAPFRNLKVLGMRNNLLNGSVESKGICELKNLTELDLGENNLEGQLPWCLSDLIGLKVLDISFNHLSGNLPSVIANLTSLEYLALSDNNFQGEFPLSLLTNHSNLEVLLLKVSSNLRLKTENWIPTFQLKVLQLPNCNLKVIPSFLLHQYDFKFLDLSSNKLVGNFPTWLMQNNTKLEVLRLSNNSFSGILQLPKVKHDLLRHLDISNNNLTGMLPQNMGIVIQKLMYIDISKNNFEGNIPYSIGEMKELFLLDLSRNKFSGDLSATSVIRCASLEYLDVSENNFYGHIFPTYMNLTQLRWLYLKNNHFTGKIKAGLLNSHGLVVLDISNNLLSGHIPCWIGNFSYLDVLLMSKNHLEGNIPVQINNFRQLQLLDLSENRLFGSIASSLNLSSIMHLYLQNNALSGQIPSTLFRSTELLTLDLRDNKFFGRIPDQINNHSELRVLLLRGNYLQGQIPIALCQLQKLGILDLSHNKLNGSIPSCFVNMLFWREGNGDLYGSGLYIYFQLGGLHSIGTYYNSTLDLWLFGDDYITLPQRARVQFVTKNRYEFYNGSNLNYMSGIDLSYNELTGEIPSEIGELPKVRALNLS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SFFLSISDREYADEILTSWVDDGISDCCDWERVTCDATAGQVIQLSLDFARMFDFYNSSDGFPILNFSLFLPFQELQILDLSGNYFDGWNENKDYDSSGSSKKLKILNLNYNNFNDSVLPYLNTLTSLTTLNLYYNRIGGLNPSQGLANLRNLKALNLSWNGISSGATRLGLGNLTNLEVLDLSANRISGSLTELAPFRNLKVLGMRNNLLNGSVESKGICELKNLTELDLGENNLEGQLPWCLSDLIGLKVLDISFNHLSGNLPSVIANLTSLEYLALSDNNFQGEFPLSLLTNHSNLEVLLLKVSSNLRLKTENWIPTFQLKVLQLPNCNLKVIPSFLLHQYDFKFLDLSSNKLVGNFPTWLMQNNTKLEVLRLSNNSFSGILQLPKVKHDLLRHLDISNNNLTGMLPQNMGIVIQKLMYIDISKNNFEGNIPYSIGEMKELFLLDLSRNKFSGDLSATSVIRCASLEYLDVSENNFYGHIFPTYMNLTQLRWLYLKNNHFTGKIKAGLLNSHGLVVLDISNNLLSGHIPCWIGNFSYLDVLLMSKNHLEGNIPVQINNFRQLQLLDLSENRLFGSIASSLNLSSIMHLYLQNNALSGQIPSTLFRSTELLTLDLRDNKFFGRIPDQINNHSELRVLLLRGNYLQGQIPIALCQLQKLGILDLSHNKLNGSIPSCFVNMLFWREGNGDLYGSGLYIYFQLGGLHSIGTYYNSTLDLWLFGDDYITLPQRARVQFVTKNRYEFYNGSNLNYMSGIDLSYNELTGEIPSEIGELPKVRALNLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FMZ, chain A
Confidence level:very confident
Coverage over the Query: 342-668
View the alignment between query and template
View the model in PyMOL
Template: 4FMZ, chain A
Confidence level:very confident
Coverage over the Query: 68-383
View the alignment between query and template
View the model in PyMOL
Template: 3V47, chain A
Confidence level:very confident
Coverage over the Query: 130-286,312-387,401-407,433-580
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 15-308
View the alignment between query and template
View the model in PyMOL
Template: 2FT3, chain A
Confidence level:very confident
Coverage over the Query: 419-684,748-782
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 75-686,698-699,716-729,748-777
View the alignment between query and template
View the model in PyMOL
Template: 3FXI, chain A
Confidence level:confident
Coverage over the Query: 104-328,341-556,573-676
View the alignment between query and template
View the model in PyMOL
Template: 3RIZ, chain A
Confidence level:confident
Coverage over the Query: 176-332,345-568,592-782
View the alignment between query and template
View the model in PyMOL