Citrus Sinensis ID: 047079


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MSSTTYPSSSYPPHAENYASPPITIILTVTLLVFFFVGFFSVYFCRCFMENIVNTWQLRQSPSGNAAGTSDSPANPGLHPSLIQAFPAFAYSTVKDFRRQKYGLECAICLAEFEDDNILRLLTVCYHVFHQECIDLWLESHKTCPVCRSDLDLPQNSLEKSPLLFRSNSMNNITGSNVSTLEDAISIFIKEDEEARGDNGEQVVNPNIIKQNERYEKIEKFSRSHSTGHSMHTTKNELEDRHTLRLPENVKLKILRGHNWTGSCITFGEFGSPVTRNNVGFGDVPRCSARTEADVV
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccEEEccccccccccccccccEEccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccc
********************PPITIILTVTLLVFFFVGFFSVYFCRCFME******************************SLIQAFPAFAYSTVKDFRRQKYGLECAICLAEFEDDNILRLLTVCYHVFHQECIDLWLESHKTCPVCRSDLD*******************************************************************************************LRLPENVKLKILRGHNWTGSCIT******************************
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSTTYPSSSYPPHAENYASPPITIILTVTLLVFFFVGFFSVYFCRCFMENIVNTWQLRQSPSGNAAGTSDSPANPGLHPSLIQAFPAFAYSTVKDFRRQKYGLECAICLAEFEDDNILRLLTVCYHVFHQECIDLWLESHKTCPVCRSDLDLPQNSLEKSPLLFRSNSMNNITGSNVSTLEDAISIFIKEDEEARGDNGEQVVNPNIIKQNERYEKIEKFSRSHSTGHSMHTTKNELEDRHTLRLPENVKLKILRGHNWTGSCITFGEFGSPVTRNNVGFGDVPRCSARTEADVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RING-H2 finger protein ATL29 probableO49691

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 71-153
View the alignment between query and template
View the model in PyMOL
Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 104-151,164-196
View the alignment between query and template
View the model in PyMOL