Citrus Sinensis ID: 047157


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------79
MALKRIVPCVLTLILKFYGLHGQTSPNISLGSSITAGSNTSWLSPSGDFAFGFYSLFGGLYLLGIWFDKIPEKTLVWAADRDSPAEAGSKITLTNDGKLLLTYFNGSVQQIYSGAASLALMQNDGNFVLKNANSAVVWDSFDFPTDTILPGQVLLTGKKLYSNSRGTADYSTGNYTLEMQADGNLVLSAYHFADPGYWYTGTVTLNNVSLIFNQSAFMYLINSTGDNIFRLTRNVMTPTEDYYHRATIDGHGNFQQFAYHKSTSSRWTRVWRAVNDPCIVNCICGVYGMCTSSDNETVTCNCIPGYTPLNPSDVSEGCHPETVVNYCAETSSKNFTVEVMDDAGFLFDNFADLARVSNVDVEGCRKAVMDDCYSLGASLVGSTCVKTRMPLLNARKSASTKGMKAIIKVPTKMSNPSNHEGKKKNNFNSRLLLKIGFIFSAICALLSGVAAIYYSPAARGLIKRRNYFDPNSMEINFREFTFQELQEATKGFSKLVGTGSSGKVYRGILRLKDTQIEIAVKKLEKDIEKTNEEFMTELKIIGRTHHKNLVRLLGFCSEEDKRLLVYELMPNGTLSNFLFHEGQRPGWVQRVEIALGVARGLLYLHEECETQIIHCDIKPQNVLLDLKTLDTNYMAKISDFGISKLLNKDQTRTDTNMRGTMGYVAPEWLRNVPVTTKVDVFSFGVMLLEIICGRRHIELSRVEEESEEVDIVLSDWVISCMLSRNLQVLVSHDPEVLSDLERFERMAMVGLWCNHPDPNLRPSMKKVIHMLEGTLEVGMPPLLHDQMS
cccccHHHHHHHHHHHHHHccccccccccccccCCcccccEEEcccccEEEEEEEcccccEEEEEEccccccccEEEEcccccccccccEEEEECcccEEEEEccccEEEEEccccEEEEEEEcccEEEEcccccEEEEcccccccccccccECccccCEEEEcccccccccccEEEEEECcccCEEEEECccccccEEccccccccEEEEEEccccEEEEEcccccCEEEEEEEEcccccEEEEEEEccccEEEEEEEEccccccEEEEEECcccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccCEEECcccccccccccccccccccccHHHHHHHHHccccEEEEECcccEEEEECcccccEEEccccccEEEEEEEccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccccccccCEEEEEEccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccEEEccccccEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEECccccccccccccccccccccccccccccccccccccccccEEEEccccccHHHHccccccccccEEEEcEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccccccc
***KRIVPCVLTLILKFYGLHGQTSPNISLGSSITAGSNTSWLSPSGDFAFGFYSLFGGLYLLGIWFDKIPEKTLVWAADRDSPAEAGSKITLTNDGKLLLTYFNGSVQQIYSGAASLALMQNDGNFVLKNANSAVVWDSFDFPTDTILPGQVLLTGKKLYSNSRGTADYSTGNYTLEMQADGNLVLSAYHFADPGYWYTGTVTLNNVSLIFNQSAFMYLINSTGDNIFRLTRNVMTPTEDYYHRATIDGHGNFQQFAYHKSTSSRWTRVWRAVNDPCIVNCICGVYGMCTSSDNETVTCNCIPGYTPLNPSDVSEGCHPETVVNYCAETSSKNFTVEVMDDAGFLFDNFADLARVSNVDVEGCRKAVMDDCYSLGASLVGSTCVKTRMPLLNARKSASTKGMKAIIKV*****************FNSRLLLKIGFIFSAICALLSGVAAIYYSPAARGLIK*********MEINFREFTFQELQEATKGFSKLVGTGSSGKVYRGILRLKDTQIEIAVKKLEKDIEKTNEEFMTELKIIGRTHHKNLVRLLGFCSEEDKRLLVYELMPNGTLSNFLFHEGQRPGWVQRVEIALGVARGLLYLHEECETQIIHCDIKPQNVLLDLKTLDTNYMAKISDFGISKLLNKDQTRTDTNMRGTMGYVAPEWLRNVPVTTKVDVFSFGVMLLEIICGRRHIELSR******EVDIVLSDWVISCMLSRNLQVLVSHDPEVLSDLERFERMAMVGLWCNHPDPNLRPSMKKVIHMLEGTLEVGM**L******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALKRIVPCVLTLILKFYGLHGQTSPNISLGSSITAGSNTSWLSPSGDFAFGFYSLFGGLYLLGIWFDKIPEKTLVWAADRDSPAEAGSKITLTNDGKLLLTYFNGSVQQIYSGAASLALMQNDGNFVLKNANSAVVWDSFDFPTDTILPGQVLLTGKKLYSNSRGTADYSTGNYTLEMQADGNLVLSAYHFADPGYWYTGTVTLNNVSLIFNQSAFMYLINSTGDNIFRLTRNVMTPTEDYYHRATIDGHGNFQQFAYHKSTSSRWTRVWRAVNDPCIVNCICGVYGMCTSSDNETVTCNCIPGYTPLNPSDVSEGCHPETVVNYCAETSSKNFTVEVMDDAGFLFDNFADLARVSNVDVEGCRKAVMDDCYSLGASLVGSTCVKTRMPLLNARKSASTKGMKAIIKVPTKMSNPSNHEGKKKNNFNSRLLLKIGFIFSAICALLSGVAAIYYSPAARGLIKRRNYFDPNSMEINFREFTFQELQEATKGFSKLVGTGSSGKVYRGILRLKxxxxxxxxxxxxxxxxxxxxxFMTELKIIGRTHHKNLVRLLGFCSEEDKRLLVYELMPNGTLSNFLFHEGQRPGWVQRVEIALGVARGLLYLHEECETQIIHCDIKPQNVLLDLKTLDTNYMAKISDFGISKLLNKDQTRTDTNMRGTMGYVAPEWLRNVPVTTKVDVFSFGVMLLEIICGRRHIELSRVEEESEEVDIVLSDWVISCMLSRNLQVLVSHDPEVLSDLERFERMAMVGLWCNHPDPNLRPSMKKVIHMLEGTLEVGMPPLLHDQMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 probableQ39202

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VHE, chain A
Confidence level:very confident
Coverage over the Query: 584-705,717-776
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 476-775
View the alignment between query and template
View the model in PyMOL
Template: 3M7H, chain A
Confidence level:very confident
Coverage over the Query: 22-275
View the alignment between query and template
View the model in PyMOL
Template: 2REI, chain A
Confidence level:confident
Coverage over the Query: 460-642,662-691
View the alignment between query and template
View the model in PyMOL
Template: 1KSW, chain A
Confidence level:probable
Coverage over the Query: 395-695
View the alignment between query and template
View the model in PyMOL
Template: 2VSE, chain A
Confidence level:probable
Coverage over the Query: 76-292
View the alignment between query and template
View the model in PyMOL