Citrus Sinensis ID: 047166

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
AVSAGNFNEEFDITWGDGRGKIFNNGQLLTLNLDRYSGSGFQSKKQHLFGKIDMQLKLVPRNSAGTVTAYYLRSQGPTWDEIDFEFLGNLSGHPYTVHTNVYSQGKGDREQQFHLWFDPAVNFHTYSVLWNPQRIVFSVDGIPIREFKNLEAIGVPFPKNQPMRIYSSLWNADDWATRGGLIKTDWSQAPFTASYRNFKVDGSRAWLLQQMDSTNQRRLYWVRKNHMIYNYCTDTKRFPQGFPKECAVH
cccccccccccEEEEcccccEEEccccEEEEEEcccccccCECccCEEEEEEEEEEEEccccccCEEEEEEEEcccccccEEEEEEccccccccEEEEEEEEEccccccCEEEEEccccccccCEEEEEECccEEEEEEccCEEEEECccccccccccccccCEEEEEECccccccccccCEECccccccEEEEEEEEEECccccHHcccccHHHHHHHHHHHHccEEEEccccccccccccccccccc
**SAGNFNEEFDITWGDGRGKIFNNGQLLTLNLDRYSGSGFQSKKQHLFGKIDMQLKLVPRNSAGTVTAYYLRSQGPTWDEIDFEFLGNLSGHPYTVHTNVYSQGKGDREQQFHLWFDPAVNFHTYSVLWNPQRIVFSVDGIPIREFKNLEAIGVPFPKNQPMRIYSSLWNADDWATRGGLIKTDWSQAPFTASYRNFKVDGSRAWLLQQMDSTNQRRLYWVRKNHMIYNYCTDTKRFPQGFPKECAV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AVSAGNFNEEFDITWGDGRGKIFNNGQLLTLNLDRYSGSGFQSKKQHLFGKIDMQLKLVPRNSAGTVTAYYLRSQGPTWDEIDFEFLGNLSGHPYTVHTNVYSQGKGDREQQFHLWFDPAVNFHTYSVLWNPQRIVFSVDGIPIREFKNLEAIGVPFPKNQPMRIYSSLWNADDWATRGGLIKTDWSQAPFTASYRNFKVDGSRAWLLQQMDSTNQRRLYWVRKNHMIYNYCTDTKRFPQGFPKECAVH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Xyloglucan endotransglucosylase/hydrolase protein 24 Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues. May be required during development to modify the walls of cells under mechanical stress.confidentP24806
Probable xyloglucan endotransglucosylase/hydrolase protein Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.probableP93349
Xyloglucan endotransglucosylase/hydrolase protein A Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.probableQ41638

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMZ, chain A
Confidence level:very confident
Coverage over the Query: 3-247
View the alignment between query and template
View the model in PyMOL