Citrus Sinensis ID: 047168

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MAQLTRSTGKVTWFDGAKGYGFIRPDDGGADLFVHQKSIKSDGYRTLYENQSVEFDVQLEADGKYQALDVTAPGGAPVHSSKNNNTNNNSGYNNNRGGRGGGGAGFGGYWKGNNDSRRNNGGGYGPGGVVCYNCDGVGHVARECTSNRRNSNYNNNSGGCYNCGDPEHFARDCPRQQGGSNSYNNNSGGCFKCGGYGHLARDCITRGSGGGGGGRCYNCGKSGHLARDCGAGGAGGGGSCFNCGKPGHFARECTKVAN
cccccccccEEEEEEcccCEEEEEcccccccEEEEEcccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
******S**KVTWFDGAKGYGFIRPDDGGADLFVHQKSIKSDGYRTLYENQSVEFDVQLEADGKYQALDVTAPGGAPVHSSKNNNTNNNSGYNNNRGGRGGGGAGFGGYW***************PGGVVCYNCDGVGHVARECT***********************************************CGGYGHLARDCI**********RCYNCGKSGHLARDCGAGGAGGGGSCFNCGKPGHFA*EC*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQLTRSTGKVTWFDGAKGYGFIRPDDGGADLFVHQKSIKSDGYRTLYENQSVEFDVQLEADGKYQALDVTAPGGAPVHSSKNNNTNNNSGYNNNRGGRGGGGAGFGGYWKGNNDSRRNNGGGYGPGGVVCYNCDGVGHVARECTSNRRNSNYNNNSGGCYNCGDPEHFARDCPRQQGGSNSYNNNSGGCFKCGGYGHLARDCITRGSGGGGGGRCYNCGKSGHLARDCGAGGAGGGGSCFNCGKPGHFARECTKVAN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cold shock protein 1 Chaperone that binds to RNA, single- (ssDNA) and double-stranded (dsDNA) DNA, and unwinds nucleic acid duplex. Exhibits a DNA melting activity. May be involved in cold resistance. Prevents seed germination under dehydration or salt stress conditions.probableO65639

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TS2, chain A
Confidence level:very confident
Coverage over the Query: 3-101
View the alignment between query and template
View the model in PyMOL
Template: 2LLI, chain A
Confidence level:very confident
Coverage over the Query: 128-146,158-176,188-256
View the alignment between query and template
View the model in PyMOL