Citrus Sinensis ID: 047168
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| 15233440 | 299 | cellular nucleic acid-binding protein [A | 0.957 | 0.826 | 0.420 | 4e-42 | |
| 297798314 | 257 | hypothetical protein ARALYDRAFT_491032 [ | 0.922 | 0.926 | 0.465 | 3e-41 | |
| 224134074 | 235 | predicted protein [Populus trichocarpa] | 0.806 | 0.885 | 0.424 | 7e-41 | |
| 255586301 | 266 | cellular nucleic acid binding protein, p | 0.899 | 0.872 | 0.514 | 4e-40 | |
| 356559280 | 250 | PREDICTED: DNA-binding protein HEXBP-lik | 0.895 | 0.924 | 0.458 | 3e-39 | |
| 294470718 | 263 | cold shock domain protein 1 [Eutrema sal | 0.914 | 0.897 | 0.433 | 7e-39 | |
| 224074255 | 225 | predicted protein [Populus trichocarpa] | 0.794 | 0.911 | 0.423 | 8e-38 | |
| 357518027 | 329 | Major cold-shock protein [Medicago trunc | 0.895 | 0.702 | 0.383 | 1e-36 | |
| 18398546 | 301 | cold shock domain protein 3 [Arabidopsis | 0.961 | 0.823 | 0.429 | 3e-36 | |
| 297836502 | 299 | hypothetical protein ARALYDRAFT_480687 [ | 0.961 | 0.829 | 0.415 | 6e-36 |
| >gi|15233440|ref|NP_195326.1| cellular nucleic acid-binding protein [Arabidopsis thaliana] gi|75318587|sp|O65639.1|CSP1_ARATH RecName: Full=Cold shock protein 1; Short=AtCSP1; AltName: Full=Cold shock domain-containing protein 1 gi|3036806|emb|CAA18496.1| glycine-rich protein [Arabidopsis thaliana] gi|7270554|emb|CAB81511.1| glycine-rich protein [Arabidopsis thaliana] gi|110741941|dbj|BAE98911.1| glycine-rich protein [Arabidopsis thaliana] gi|332661203|gb|AEE86603.1| cellular nucleic acid-binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 177 bits (449), Expect = 4e-42, Method: Compositional matrix adjust.
Identities = 124/295 (42%), Positives = 151/295 (51%), Gaps = 48/295 (16%)
Query: 6 RSTGKVTWFDGAKGYGFIRPDDGGADLFVHQKSIKSDGYRTLYENQSVEFDVQLEADGKY 65
RSTGKV WF+ +KGYGFI PDDG +LFVHQ SI S+GYR+L +VEF + +DGK
Sbjct: 10 RSTGKVNWFNASKGYGFITPDDGSVELFVHQSSIVSEGYRSLTVGDAVEFAITQGSDGKT 69
Query: 66 QALDVTAPGGAPVHSSKNNNTNNNSGYNNNRGGRGGGGAGFGGYWKG-NNDSRRNNGGGY 124
+A++VTAPGG + K NN+ N G G K G
Sbjct: 70 KAVNVTAPGGGSL--KKENNSRGNGARRGGGGSGCYNCGELGHISKDCGIGGGGGGGERR 127
Query: 125 GPGGVVCYNCDGVGHVARECTS----NRRNSNYNNNSG---------------------- 158
GG CYNC GH AR+CTS ++R + N G
Sbjct: 128 SRGGEGCYNCGDTGHFARDCTSAGNGDQRGATKGGNDGCYTCGDVGHVARDCTQKSVGNG 187
Query: 159 -----------GCYNCGDPEHFARDCPRQQGGSNSYN--NNSGGCFKCGGYGHLARDCIT 205
GCY CGD HFARDC ++ N + SG C+ CGG GH+ARDC T
Sbjct: 188 DQRGAVKGGNDGCYTCGDVGHFARDCTQKVAAGNVRSGGGGSGTCYSCGGVGHIARDCAT 247
Query: 206 RGSGGGGGGRCYNCGKSGHLARDCGAGGAGGGG---SCFNCGKPGHFARECTKVA 257
+ G CY CG SGHLARDC G+GGGG +C+ CGK GHFAREC+ VA
Sbjct: 248 KRQPSRG---CYQCGGSGHLARDCDQRGSGGGGNDNACYKCGKEGHFARECSSVA 299
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297798314|ref|XP_002867041.1| hypothetical protein ARALYDRAFT_491032 [Arabidopsis lyrata subsp. lyrata] gi|297312877|gb|EFH43300.1| hypothetical protein ARALYDRAFT_491032 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224134074|ref|XP_002327749.1| predicted protein [Populus trichocarpa] gi|222836834|gb|EEE75227.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255586301|ref|XP_002533802.1| cellular nucleic acid binding protein, putative [Ricinus communis] gi|223526275|gb|EEF28589.1| cellular nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356559280|ref|XP_003547928.1| PREDICTED: DNA-binding protein HEXBP-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|294470718|gb|ADE80751.1| cold shock domain protein 1 [Eutrema salsugineum] | Back alignment and taxonomy information |
|---|
| >gi|224074255|ref|XP_002304323.1| predicted protein [Populus trichocarpa] gi|222841755|gb|EEE79302.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357518027|ref|XP_003629302.1| Major cold-shock protein [Medicago truncatula] gi|355523324|gb|AET03778.1| Major cold-shock protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|18398546|ref|NP_565427.1| cold shock domain protein 3 [Arabidopsis thaliana] gi|75165198|sp|Q94C69.1|CSP3_ARATH RecName: Full=Cold shock domain-containing protein 3; Short=AtCSP3 gi|14334920|gb|AAK59638.1| putative glycine-rich, zinc-finger DNA-binding protein [Arabidopsis thaliana] gi|17104541|gb|AAL34159.1| putative glycine-rich, zinc-finger DNA-binding protein [Arabidopsis thaliana] gi|148726892|dbj|BAF63841.1| cold shock domain protein 3 [Arabidopsis thaliana] gi|330251603|gb|AEC06697.1| cold shock domain protein 3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297836502|ref|XP_002886133.1| hypothetical protein ARALYDRAFT_480687 [Arabidopsis lyrata subsp. lyrata] gi|297331973|gb|EFH62392.1| hypothetical protein ARALYDRAFT_480687 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| TAIR|locus:2135139 | 299 | CSDP1 "cold shock domain prote | 0.271 | 0.234 | 0.614 | 6.4e-37 | |
| TAIR|locus:2827810 | 301 | CSP3 "cold shock domain protei | 0.298 | 0.255 | 0.571 | 3.1e-35 | |
| TAIR|locus:2121219 | 203 | GRP2 "AT4G38680" [Arabidopsis | 0.294 | 0.374 | 0.526 | 1.1e-31 | |
| TAIR|locus:2047092 | 201 | GRP2B "glycine-rich protein 2B | 0.294 | 0.378 | 0.539 | 1.3e-31 | |
| FB|FBgn0035626 | 195 | lin-28 "lin-28" [Drosophila me | 0.279 | 0.369 | 0.424 | 3.5e-15 | |
| ZFIN|ZDB-GENE-040426-747 | 202 | lin28a "lin-28 homolog A (C. e | 0.286 | 0.366 | 0.373 | 1.5e-14 | |
| UNIPROTKB|Q6ZN17 | 250 | LIN28B "Protein lin-28 homolog | 0.310 | 0.32 | 0.363 | 1.6e-13 | |
| TIGR_CMR|SO_1648 | 69 | SO_1648 "cold shock domain fam | 0.255 | 0.956 | 0.492 | 4.4e-13 | |
| UNIPROTKB|F1P7H7 | 251 | LIN28B "Uncharacterized protei | 0.310 | 0.318 | 0.352 | 5.1e-13 | |
| UNIPROTKB|D4A0Q1 | 247 | Lin28b "Protein Lin28b" [Rattu | 0.310 | 0.323 | 0.363 | 5.8e-13 |
| TAIR|locus:2135139 CSDP1 "cold shock domain protein 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 233 (87.1 bits), Expect = 6.4e-37, Sum P(2) = 6.4e-37
Identities = 43/70 (61%), Positives = 54/70 (77%)
Query: 6 RSTGKVTWFDGAKGYGFIRPDDGGADLFVHQKSIKSDGYRTLYENQSVEFDVQLEADGKY 65
RSTGKV WF+ +KGYGFI PDDG +LFVHQ SI S+GYR+L +VEF + +DGK
Sbjct: 10 RSTGKVNWFNASKGYGFITPDDGSVELFVHQSSIVSEGYRSLTVGDAVEFAITQGSDGKT 69
Query: 66 QALDVTAPGG 75
+A++VTAPGG
Sbjct: 70 KAVNVTAPGG 79
|
|
| TAIR|locus:2827810 CSP3 "cold shock domain protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121219 GRP2 "AT4G38680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2047092 GRP2B "glycine-rich protein 2B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0035626 lin-28 "lin-28" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-747 lin28a "lin-28 homolog A (C. elegans)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZN17 LIN28B "Protein lin-28 homolog B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1648 SO_1648 "cold shock domain family protein" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P7H7 LIN28B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A0Q1 Lin28b "Protein Lin28b" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| CSDP1 | CSDP1 (cold shock domain protein 1); RNA binding / double-stranded DNA binding / nucleic acid binding / single-stranded DNA binding; Encodes a cold shock domain protein. Involved in cold acclimation by blocking the secondary structure of mRNA which in turn facilitates translation at cold temperature. (299 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| SRZ-22 | • | • | • | 0.943 | |||||||
| AT2G17870 | • | • | • | • | • | 0.928 | |||||
| SmD3 | • | • | 0.921 | ||||||||
| NRPB12 | • | • | 0.918 | ||||||||
| AT2G24590 | • | • | • | 0.916 | |||||||
| ATGRP2B | • | • | • | • | 0.913 | ||||||
| GRP2 | • | • | • | • | 0.912 | ||||||
| NRPB5 | • | • | 0.912 | ||||||||
| EMB2770 | • | • | 0.909 | ||||||||
| NRPB7 | • | • | 0.909 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 8e-30 | |
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 5e-27 | |
| pfam00313 | 66 | pfam00313, CSD, 'Cold-shock' DNA-binding domain | 2e-23 | |
| cd04458 | 65 | cd04458, CSP_CDS, Cold-Shock Protein (CSP) contain | 3e-23 | |
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 2e-22 | |
| COG1278 | 67 | COG1278, CspC, Cold shock proteins [Transcription] | 6e-20 | |
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 9e-20 | |
| COG5082 | 190 | COG5082, AIR1, Arginine methyltransferase-interact | 4e-16 | |
| smart00357 | 64 | smart00357, CSP, Cold shock protein domain | 2e-15 | |
| TIGR02381 | 68 | TIGR02381, cspD, cold shock domain protein CspD | 7e-15 | |
| PRK09890 | 70 | PRK09890, PRK09890, cold shock protein CspG; Provi | 8e-15 | |
| PRK09507 | 69 | PRK09507, cspE, cold shock protein CspE; Reviewed | 3e-14 | |
| PRK14998 | 73 | PRK14998, PRK14998, cold shock-like protein CspD; | 3e-13 | |
| PRK10354 | 70 | PRK10354, PRK10354, RNA chaperone/anti-terminator; | 3e-13 | |
| PRK09937 | 74 | PRK09937, PRK09937, stationary phase/starvation in | 3e-13 | |
| PRK10943 | 69 | PRK10943, PRK10943, cold shock-like protein CspC; | 5e-13 | |
| COG5082 | 190 | COG5082, AIR1, Arginine methyltransferase-interact | 4e-10 | |
| COG5082 | 190 | COG5082, AIR1, Arginine methyltransferase-interact | 5e-10 | |
| COG5082 | 190 | COG5082, AIR1, Arginine methyltransferase-interact | 6e-10 | |
| COG5082 | 190 | COG5082, AIR1, Arginine methyltransferase-interact | 4e-07 | |
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 4e-06 | |
| PTZ00368 | 148 | PTZ00368, PTZ00368, universal minicircle sequence | 1e-05 | |
| pfam00098 | 18 | pfam00098, zf-CCHC, Zinc knuckle | 7e-04 | |
| smart00343 | 17 | smart00343, ZnF_C2HC, zinc finger | 0.002 | |
| PRK15463 | 70 | PRK15463, PRK15463, cold shock-like protein CspF; | 0.003 | |
| pfam00098 | 18 | pfam00098, zf-CCHC, Zinc knuckle | 0.004 |
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
Score = 108 bits (272), Expect = 8e-30
Identities = 52/129 (40%), Positives = 68/129 (52%), Gaps = 11/129 (8%)
Query: 127 GGVVCYNCDGVGHVARECTSNRRNSNYNNNSGGCYNCGDPEHFARDCPRQQGGSNSYNNN 186
CY C GH++REC S CYNCG H +R+CP GS +
Sbjct: 26 KARPCYKCGEPGHLSRECPSAPGGRG----ERSCYNCGKTGHLSRECPEAPPGSGPRS-- 79
Query: 187 SGGCFKCGGYGHLARDCITRGSGGGGGGRCYNCGKSGHLARDC-GAGGAGGGG-SCFNCG 244
C+ CG GH++R+C R GG CYNCG GH++RDC AG GG +C+NCG
Sbjct: 80 ---CYNCGQTGHISRECPNRAKGGAARRACYNCGGEGHISRDCPNAGKRPGGDKTCYNCG 136
Query: 245 KPGHFAREC 253
+ GH +R+C
Sbjct: 137 QTGHLSRDC 145
|
Length = 148 |
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201147 pfam00313, CSD, 'Cold-shock' DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239905 cd04458, CSP_CDS, Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea | Back alignment and domain information |
|---|
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224197 COG1278, CspC, Cold shock proteins [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227414 COG5082, AIR1, Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|214633 smart00357, CSP, Cold shock protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|131434 TIGR02381, cspD, cold shock domain protein CspD | Back alignment and domain information |
|---|
| >gnl|CDD|77467 PRK09890, PRK09890, cold shock protein CspG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169931 PRK09507, cspE, cold shock protein CspE; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184960 PRK14998, PRK14998, cold shock-like protein CspD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182402 PRK10354, PRK10354, RNA chaperone/anti-terminator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|77494 PRK09937, PRK09937, stationary phase/starvation inducible regulatory protein CspD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|170841 PRK10943, PRK10943, cold shock-like protein CspC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227414 COG5082, AIR1, Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227414 COG5082, AIR1, Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227414 COG5082, AIR1, Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|227414 COG5082, AIR1, Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|189387 pfam00098, zf-CCHC, Zinc knuckle | Back alignment and domain information |
|---|
| >gnl|CDD|197667 smart00343, ZnF_C2HC, zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|185360 PRK15463, PRK15463, cold shock-like protein CspF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|189387 pfam00098, zf-CCHC, Zinc knuckle | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| PTZ00368 | 148 | universal minicircle sequence binding protein (UMS | 99.96 | |
| COG1278 | 67 | CspC Cold shock proteins [Transcription] | 99.92 | |
| PRK10943 | 69 | cold shock-like protein CspC; Provisional | 99.9 | |
| PRK15464 | 70 | cold shock-like protein CspH; Provisional | 99.9 | |
| PTZ00368 | 148 | universal minicircle sequence binding protein (UMS | 99.89 | |
| PRK15463 | 70 | cold shock-like protein CspF; Provisional | 99.89 | |
| PRK09507 | 69 | cspE cold shock protein CspE; Reviewed | 99.89 | |
| PRK09890 | 70 | cold shock protein CspG; Provisional | 99.89 | |
| PRK10354 | 70 | RNA chaperone/anti-terminator; Provisional | 99.89 | |
| PRK14998 | 73 | cold shock-like protein CspD; Provisional | 99.89 | |
| PRK09937 | 74 | stationary phase/starvation inducible regulatory p | 99.89 | |
| TIGR02381 | 68 | cspD cold shock domain protein CspD. This model re | 99.88 | |
| PF00313 | 66 | CSD: 'Cold-shock' DNA-binding domain; InterPro: IP | 99.84 | |
| cd04458 | 65 | CSP_CDS Cold-Shock Protein (CSP) contains an S1-li | 99.82 | |
| COG5082 | 190 | AIR1 Arginine methyltransferase-interacting protei | 99.8 | |
| COG5082 | 190 | AIR1 Arginine methyltransferase-interacting protei | 99.8 | |
| KOG3070 | 235 | consensus Predicted RNA-binding protein containing | 99.74 | |
| KOG4400 | 261 | consensus E3 ubiquitin ligase interacting with arg | 99.58 | |
| KOG4400 | 261 | consensus E3 ubiquitin ligase interacting with arg | 99.53 | |
| smart00357 | 64 | CSP Cold shock protein domain. RNA-binding domain | 98.94 | |
| PF00098 | 18 | zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi | 98.2 | |
| PF00098 | 18 | zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi | 98.03 | |
| PF08206 | 58 | OB_RNB: Ribonuclease B OB domain; InterPro: IPR013 | 97.7 | |
| PF14444 | 58 | S1-like: S1-like | 97.21 | |
| PF13696 | 32 | zf-CCHC_2: Zinc knuckle | 96.65 | |
| PF13696 | 32 | zf-CCHC_2: Zinc knuckle | 96.65 | |
| PF07497 | 78 | Rho_RNA_bind: Rho termination factor, RNA-binding | 96.37 | |
| cd04459 | 68 | Rho_CSD Rho_CSD: Rho protein cold-shock domain (CS | 96.14 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 95.5 | |
| PF13917 | 42 | zf-CCHC_3: Zinc knuckle | 95.19 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 94.65 | |
| smart00343 | 26 | ZnF_C2HC zinc finger. | 94.41 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 93.94 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 93.46 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 93.4 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 92.95 | |
| smart00343 | 26 | ZnF_C2HC zinc finger. | 92.84 | |
| PF13917 | 42 | zf-CCHC_3: Zinc knuckle | 92.76 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 92.76 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 91.57 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 91.31 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 90.76 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 90.67 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 90.6 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 90.03 | |
| PF14392 | 49 | zf-CCHC_4: Zinc knuckle | 89.62 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 89.42 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 89.34 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 89.22 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 89.14 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 89.14 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 88.99 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 88.91 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 88.72 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 88.54 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 88.46 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 88.25 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 87.93 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 87.76 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 87.46 | |
| PF15288 | 40 | zf-CCHC_6: Zinc knuckle | 87.42 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 86.83 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 86.7 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 86.69 | |
| KOG0314 | 448 | consensus Predicted E3 ubiquitin ligase [Posttrans | 86.48 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 86.12 | |
| PF14392 | 49 | zf-CCHC_4: Zinc knuckle | 85.94 | |
| COG1158 | 422 | Rho Transcription termination factor [Transcriptio | 85.36 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 84.95 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 84.93 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 84.71 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 84.63 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 84.32 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 83.07 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 82.49 | |
| PF15288 | 40 | zf-CCHC_6: Zinc knuckle | 82.01 | |
| KOG0314 | 448 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.76 | |
| PF14787 | 36 | zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: | 80.7 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 80.57 |
| >PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
Probab=99.96 E-value=5.3e-29 Score=203.47 Aligned_cols=145 Identities=36% Similarity=0.906 Sum_probs=118.6
Q ss_pred CCccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccCCCCccccccccccCCCCCCCCCCCcccCCCCCCC
Q 047168 90 SGYNNNRGGRGGGGAGFGGYWKGNNDSRRNNGGGYGPGGVVCYNCDGVGHVARECTSNRRNSNYNNNSGGCYNCGDPEHF 169 (258)
Q Consensus 90 ~c~~c~~~g~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~C~~Cg~~GH~a~~Cp~~~~~~~~~~~~~~C~~Cg~~GH~ 169 (258)
+|+||++.||++ .+||+.... ...+...||+|++.||++++||.... ......|++|++.||+
T Consensus 2 ~C~~C~~~GH~~---------~~c~~~~~~----~~~~~~~C~~Cg~~GH~~~~Cp~~~~----~~~~~~C~~Cg~~GH~ 64 (148)
T PTZ00368 2 VCYRCGGVGHQS---------RECPNSAPA----GAAKARPCYKCGEPGHLSRECPSAPG----GRGERSCYNCGKTGHL 64 (148)
T ss_pred cCCCCCCCCcCc---------ccCcCCCCC----CCCCCccCccCCCCCcCcccCcCCCC----CCCCcccCCCCCcCcC
Confidence 699999999998 899975431 12347899999999999999998432 1235689999999999
Q ss_pred CCCCCCCCCCCCCCCCCCCcccccCCcccCcccCCCCCCCCCCCCccccCCCCCccCCCCCCCCC--CCCCccccCCCCC
Q 047168 170 ARDCPRQQGGSNSYNNNSGGCFKCGGYGHLARDCITRGSGGGGGGRCYNCGKSGHLARDCGAGGA--GGGGSCFNCGKPG 247 (258)
Q Consensus 170 ~~~Cp~~~~~~~~~~~~~~~C~~Cg~~GH~~~~C~~~~~~~~~~~~C~~Cg~~GH~~~~Cp~~~~--~~~~~C~~Cg~~G 247 (258)
+++||+... ......|++|++.||++++||+..........||+|++.||++++||+.+. .....||+|++.|
T Consensus 65 ~~~Cp~~~~-----~~~~~~C~~Cg~~GH~~~~C~~~~~~~~~~~~C~~Cg~~gH~~~~C~~~~~~~~~~~~C~~Cg~~g 139 (148)
T PTZ00368 65 SRECPEAPP-----GSGPRSCYNCGQTGHISRECPNRAKGGAARRACYNCGGEGHISRDCPNAGKRPGGDKTCYNCGQTG 139 (148)
T ss_pred cccCCCccc-----CCCCcccCcCCCCCcccccCCCcccccccchhhcccCcCCcchhcCCCccccCCCCCccccCCCcC
Confidence 999998742 124578999999999999999975444455689999999999999999632 2356999999999
Q ss_pred ccCCCCCCC
Q 047168 248 HFARECTKV 256 (258)
Q Consensus 248 H~~~~Cp~~ 256 (258)
||++|||++
T Consensus 140 H~~~dCp~~ 148 (148)
T PTZ00368 140 HLSRDCPDK 148 (148)
T ss_pred cccccCCCC
Confidence 999999985
|
|
| >COG1278 CspC Cold shock proteins [Transcription] | Back alignment and domain information |
|---|
| >PRK10943 cold shock-like protein CspC; Provisional | Back alignment and domain information |
|---|
| >PRK15464 cold shock-like protein CspH; Provisional | Back alignment and domain information |
|---|
| >PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >PRK15463 cold shock-like protein CspF; Provisional | Back alignment and domain information |
|---|
| >PRK09507 cspE cold shock protein CspE; Reviewed | Back alignment and domain information |
|---|
| >PRK09890 cold shock protein CspG; Provisional | Back alignment and domain information |
|---|
| >PRK10354 RNA chaperone/anti-terminator; Provisional | Back alignment and domain information |
|---|
| >PRK14998 cold shock-like protein CspD; Provisional | Back alignment and domain information |
|---|
| >PRK09937 stationary phase/starvation inducible regulatory protein CspD; Provisional | Back alignment and domain information |
|---|
| >TIGR02381 cspD cold shock domain protein CspD | Back alignment and domain information |
|---|
| >PF00313 CSD: 'Cold-shock' DNA-binding domain; InterPro: IPR002059 When Escherichia coli is exposed to a temperature drop from 37 to 10 degrees centigrade, a 4-5 hour lag phase occurs, after which growth is resumed at a reduced rate [] | Back alignment and domain information |
|---|
| >cd04458 CSP_CDS Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea | Back alignment and domain information |
|---|
| >COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3070 consensus Predicted RNA-binding protein containing PIN domain and invovled in translation or RNA processing [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00357 CSP Cold shock protein domain | Back alignment and domain information |
|---|
| >PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF08206 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies | Back alignment and domain information |
|---|
| >PF14444 S1-like: S1-like | Back alignment and domain information |
|---|
| >PF13696 zf-CCHC_2: Zinc knuckle | Back alignment and domain information |
|---|
| >PF13696 zf-CCHC_2: Zinc knuckle | Back alignment and domain information |
|---|
| >PF07497 Rho_RNA_bind: Rho termination factor, RNA-binding domain; InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts | Back alignment and domain information |
|---|
| >cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD) | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >PF13917 zf-CCHC_3: Zinc knuckle | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00343 ZnF_C2HC zinc finger | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >smart00343 ZnF_C2HC zinc finger | Back alignment and domain information |
|---|
| >PF13917 zf-CCHC_3: Zinc knuckle | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14392 zf-CCHC_4: Zinc knuckle | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PF15288 zf-CCHC_6: Zinc knuckle | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG0314 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PF14392 zf-CCHC_4: Zinc knuckle | Back alignment and domain information |
|---|
| >COG1158 Rho Transcription termination factor [Transcription] | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF15288 zf-CCHC_6: Zinc knuckle | Back alignment and domain information |
|---|
| >KOG0314 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 258 | ||||
| 3i2z_B | 71 | Structure Of Cold Shock Protein E From Salmonella T | 2e-12 | ||
| 3cam_A | 67 | Crystal Structure Of The Cold Shock Domain Protein | 2e-12 | ||
| 2l15_A | 70 | Solution Structure Of Cold Shock Protein Cspa Using | 1e-11 | ||
| 1mjc_A | 69 | Crystal Structure Of Cspa, The Major Cold Shock Pro | 2e-11 | ||
| 3mef_A | 69 | Major Cold-Shock Protein From Escherichia Coli Solu | 2e-11 | ||
| 1g6p_A | 66 | Solution Nmr Structure Of The Cold Shock Protein Fr | 4e-11 | ||
| 4a4i_A | 90 | Crystal Structure Of The Human Lin28b Cold Shock Do | 9e-10 | ||
| 2lss_A | 70 | Solution Structure Of The R. Rickettsii Cold Shock- | 1e-09 | ||
| 3ulj_A | 90 | Crystal Structure Of Apo Lin28b Cold Shock Domain L | 1e-09 | ||
| 1hza_A | 67 | Bacillus Caldolyticus Cold-Shock Protein Mutants To | 3e-09 | ||
| 1hz9_A | 66 | Bacillus Caldolyticus Cold-Shock Protein Mutants To | 3e-09 | ||
| 3a0j_A | 73 | Crystal Structure Of Cold Shock Protein 1 From Ther | 3e-09 | ||
| 1i5f_A | 66 | Bacillus Caldolyticus Cold-Shock Protein Mutants To | 4e-09 | ||
| 1hzc_A | 66 | Bacillus Caldolyticus Cold-Shock Protein Mutants To | 4e-09 | ||
| 1c9o_A | 66 | Crystal Structure Analysis Of The Bacillus Caldolyt | 4e-09 | ||
| 1h95_A | 79 | Solution Structure Of The Single-Stranded Dna-Bindi | 4e-09 | ||
| 1hzb_A | 66 | Bacillus Caldolyticus Cold-Shock Protein Mutants To | 6e-09 | ||
| 2i5l_X | 67 | Crystal Structure Of Bacillus Subtilis Cold Shock P | 1e-08 | ||
| 2es2_A | 67 | Crystal Structure Analysis Of The Bacillus Subtilis | 2e-08 | ||
| 2i5m_X | 67 | Crystal Structure Of Bacillus Subtilis Cold Shock P | 3e-08 | ||
| 3trz_A | 148 | Mouse Lin28a In Complex With Let-7d Microrna Pre-El | 1e-07 | ||
| 3ts0_A | 146 | Mouse Lin28a In Complex With Let-7f-1 Microrna Pre- | 1e-07 | ||
| 2bh8_A | 101 | Combinatorial Protein 1b11 Length = 101 | 5e-05 |
| >pdb|3I2Z|B Chain B, Structure Of Cold Shock Protein E From Salmonella Typhimurium Length = 71 | Back alignment and structure |
|
| >pdb|3CAM|A Chain A, Crystal Structure Of The Cold Shock Domain Protein From Neisseria Meningitidis Length = 67 | Back alignment and structure |
| >pdb|2L15|A Chain A, Solution Structure Of Cold Shock Protein Cspa Using Combined Nmr And Cs-Rosetta Method Length = 70 | Back alignment and structure |
| >pdb|1MJC|A Chain A, Crystal Structure Of Cspa, The Major Cold Shock Protein Of Escherichia Coli Length = 69 | Back alignment and structure |
| >pdb|3MEF|A Chain A, Major Cold-Shock Protein From Escherichia Coli Solution Nmr Structure Length = 69 | Back alignment and structure |
| >pdb|1G6P|A Chain A, Solution Nmr Structure Of The Cold Shock Protein From The Hyperthermophilic Bacterium Thermotoga Maritima Length = 66 | Back alignment and structure |
| >pdb|4A4I|A Chain A, Crystal Structure Of The Human Lin28b Cold Shock Domain Length = 90 | Back alignment and structure |
| >pdb|2LSS|A Chain A, Solution Structure Of The R. Rickettsii Cold Shock-like Protein Length = 70 | Back alignment and structure |
| >pdb|3ULJ|A Chain A, Crystal Structure Of Apo Lin28b Cold Shock Domain Length = 90 | Back alignment and structure |
| >pdb|1HZA|A Chain A, Bacillus Caldolyticus Cold-Shock Protein Mutants To Study Determinants Of Protein Stability Length = 67 | Back alignment and structure |
| >pdb|1HZ9|A Chain A, Bacillus Caldolyticus Cold-Shock Protein Mutants To Study Determinants Of Protein Stability Length = 66 | Back alignment and structure |
| >pdb|3A0J|A Chain A, Crystal Structure Of Cold Shock Protein 1 From Thermus Thermophilus Hb8 Length = 73 | Back alignment and structure |
| >pdb|1I5F|A Chain A, Bacillus Caldolyticus Cold-Shock Protein Mutants To Study Determinants Of Protein Stability Length = 66 | Back alignment and structure |
| >pdb|1HZC|A Chain A, Bacillus Caldolyticus Cold-Shock Protein Mutants To Study Determinants Of Protein Stability Length = 66 | Back alignment and structure |
| >pdb|1C9O|A Chain A, Crystal Structure Analysis Of The Bacillus Caldolyticus Cold Shock Protein Bc-Csp Length = 66 | Back alignment and structure |
| >pdb|1H95|A Chain A, Solution Structure Of The Single-Stranded Dna-Binding Cold Shock Domain (Csd) Of Human Y-Box Protein 1 (Yb1) Determined By Nmr (10 Lowest Energy Structures) Length = 79 | Back alignment and structure |
| >pdb|1HZB|A Chain A, Bacillus Caldolyticus Cold-Shock Protein Mutants To Study Determinants Of Protein Stability Length = 66 | Back alignment and structure |
| >pdb|2I5L|X Chain X, Crystal Structure Of Bacillus Subtilis Cold Shock Protein Variant Bs-Cspb M1rE3KK65I Length = 67 | Back alignment and structure |
| >pdb|2ES2|A Chain A, Crystal Structure Analysis Of The Bacillus Subtilis Cold Shock Protein Bs-Cspb In Complex With Hexathymidine Length = 67 | Back alignment and structure |
| >pdb|2I5M|X Chain X, Crystal Structure Of Bacillus Subtilis Cold Shock Protein Cspb Variant A46k S48r Length = 67 | Back alignment and structure |
| >pdb|3TRZ|A Chain A, Mouse Lin28a In Complex With Let-7d Microrna Pre-Element Length = 148 | Back alignment and structure |
| >pdb|3TS0|A Chain A, Mouse Lin28a In Complex With Let-7f-1 Microrna Pre-Element Length = 146 | Back alignment and structure |
| >pdb|2BH8|A Chain A, Combinatorial Protein 1b11 Length = 101 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 6e-27 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 2e-08 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 7e-08 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 8e-05 | |
| 3ulj_A | 90 | LIN28B, DNA-binding protein; beta barrel, cold sho | 3e-26 | |
| 2lss_A | 70 | Cold shock-like protein; CSD, CSP, oligonucleotide | 2e-24 | |
| 3i2z_B | 71 | RNA chaperone, negative regulator of CSPA transcri | 3e-24 | |
| 3cam_A | 67 | Cold-shock domain family protein; cold shock prote | 3e-24 | |
| 1h95_A | 79 | CSD, Y-box binding protein; translation factor, tr | 1e-23 | |
| 3aqq_A | 147 | Calcium-regulated heat stable protein 1; compact b | 5e-22 | |
| 1g6p_A | 66 | Cold shock protein TMCSP; greek-KEY, beta barrel, | 1e-20 | |
| 1c9o_A | 66 | CSPB, cold-shock protein; beta barrel, homodimer, | 2e-20 | |
| 3a0j_A | 73 | Cold shock protein; OB-fold, cytoplasm, transcript | 3e-20 | |
| 2kcm_A | 74 | Cold shock domain family protein; nucleic acid bin | 7e-20 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 1e-17 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 2e-10 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 4e-05 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 7e-17 | |
| 2k5n_A | 74 | Putative cold-shock protein; GFT protein structure | 1e-15 | |
| 2ytx_A | 97 | Cold shock domain-containing protein E1; cell-free | 1e-13 | |
| 2yty_A | 88 | Cold shock domain-containing protein E1; cell-free | 9e-13 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 2e-10 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 2e-09 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 1e-08 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 3e-08 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 3e-10 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 9e-10 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 4e-08 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 4e-07 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 3e-08 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 1e-06 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 2e-05 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 1e-04 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 4e-08 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 5e-07 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 3e-06 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 1e-06 | |
| 1x65_A | 89 | UNR protein; cell-free protein synthesis, beta-bar | 4e-06 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 8e-06 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 4e-04 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 8e-06 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 4e-04 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 2e-05 | |
| 1wfq_A | 89 | UNR protein; beta-barrel, translational regulation | 3e-05 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 5e-05 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 7e-04 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 5e-05 | |
| 3gv2_A | 342 | Ca, fusion protein consisting of capsid protein P2 | 3e-04 |
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Length = 148 | Back alignment and structure |
|---|
Score = 100 bits (251), Expect = 6e-27
Identities = 43/181 (23%), Positives = 63/181 (34%), Gaps = 55/181 (30%)
Query: 3 QLTRSTGKVTWFDGAKGYGFIRPD-------DGGADLFVHQKSIKSDGYRTLYENQSVEF 55
QL G WF+ G+GF+ D D+FVHQ + +G+R+L E ++VEF
Sbjct: 6 QLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEF 65
Query: 56 DVQLEADGKYQALDVTAPGGAPVHSSKNNNTNNNSGYNNNRGGRGGGGAGFGGYWKGNND 115
+ A G +++ VT PGG G+
Sbjct: 66 TFKKSAKG-LESIRVTGPGGVFC--------------------------------IGSER 92
Query: 116 SRRNNGGGYGPGGVVCYNCDGVGHVARECTSNRRNSNYNNNSGGCYNCGDPEHFARDCPR 175
+ CYNC G+ H A+EC C+ C H CP
Sbjct: 93 RPKGGDR--------CYNCGGLDHHAKEC-------KLPPQPKKCHFCQSINHMVASCPL 137
Query: 176 Q 176
+
Sbjct: 138 K 138
|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Length = 148 | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Length = 148 | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Length = 148 | Back alignment and structure |
|---|
| >3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A Length = 90 | Back alignment and structure |
|---|
| >2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} Length = 70 | Back alignment and structure |
|---|
| >3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} PDB: 2l15_A 1mjc_A 3mef_A Length = 71 | Back alignment and structure |
|---|
| >3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} Length = 67 | Back alignment and structure |
|---|
| >1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 79 | Back alignment and structure |
|---|
| >3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 Length = 66 | Back alignment and structure |
|---|
| >1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X Length = 66 | Back alignment and structure |
|---|
| >3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} Length = 73 | Back alignment and structure |
|---|
| >2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} Length = 74 | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Length = 124 | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Length = 124 | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Length = 124 | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Length = 101 | Back alignment and structure |
|---|
| >2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} Length = 74 | Back alignment and structure |
|---|
| >2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Length = 60 | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Length = 60 | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Length = 60 | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Length = 60 | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Length = 61 | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Length = 61 | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Length = 61 | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Length = 61 | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Length = 37 | Back alignment and structure |
|---|
| >1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology protein; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Length = 39 | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Length = 39 | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Length = 83 | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Length = 83 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 89 | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Length = 49 | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Length = 49 | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Length = 55 | Back alignment and structure |
|---|
| >3gv2_A Ca, fusion protein consisting of capsid protein P24, linker and carbon dioxide-concentrating...; hexameric retroviral capsid; 7.00A {Human immunodeficiency virus type 1} Length = 342 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 100.0 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 99.94 | |
| 3ulj_A | 90 | LIN28B, DNA-binding protein; beta barrel, cold sho | 99.93 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 99.91 | |
| 3i2z_B | 71 | RNA chaperone, negative regulator of CSPA transcri | 99.91 | |
| 3cam_A | 67 | Cold-shock domain family protein; cold shock prote | 99.9 | |
| 1h95_A | 79 | CSD, Y-box binding protein; translation factor, tr | 99.9 | |
| 1c9o_A | 66 | CSPB, cold-shock protein; beta barrel, homodimer, | 99.89 | |
| 3a0j_A | 73 | Cold shock protein; OB-fold, cytoplasm, transcript | 99.89 | |
| 2kcm_A | 74 | Cold shock domain family protein; nucleic acid bin | 99.89 | |
| 1g6p_A | 66 | Cold shock protein TMCSP; greek-KEY, beta barrel, | 99.89 | |
| 2lss_A | 70 | Cold shock-like protein; CSD, CSP, oligonucleotide | 99.81 | |
| 2k5n_A | 74 | Putative cold-shock protein; GFT protein structure | 99.88 | |
| 1wfq_A | 89 | UNR protein; beta-barrel, translational regulation | 99.87 | |
| 2yty_A | 88 | Cold shock domain-containing protein E1; cell-free | 99.85 | |
| 1x65_A | 89 | UNR protein; cell-free protein synthesis, beta-bar | 99.83 | |
| 3aqq_A | 147 | Calcium-regulated heat stable protein 1; compact b | 99.82 | |
| 2ytx_A | 97 | Cold shock domain-containing protein E1; cell-free | 99.81 | |
| 2ytv_A | 79 | Cold shock domain-containing protein E1; cell-free | 99.79 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 99.65 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 99.64 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 99.52 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 99.51 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 99.45 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 99.34 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 99.28 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 99.24 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 99.23 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 99.22 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 99.19 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 99.19 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 99.19 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 99.18 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 99.17 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 99.13 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 99.11 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 99.05 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 99.02 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 98.99 | |
| 1dsq_A | 26 | Nucleic acid binding protein P14; CCHC type zinc f | 97.99 | |
| 1dsq_A | 26 | Nucleic acid binding protein P14; CCHC type zinc f | 97.94 | |
| 1a6b_B | 40 | Momulv, zinc finger protein NCP10; nucleocapsid pr | 97.8 | |
| 1nc8_A | 29 | Nucleocapsid protein; HIV-2, RNA recognition, zinc | 97.78 | |
| 1nc8_A | 29 | Nucleocapsid protein; HIV-2, RNA recognition, zinc | 97.74 | |
| 1a6b_B | 40 | Momulv, zinc finger protein NCP10; nucleocapsid pr | 97.51 | |
| 1u6p_A | 56 | GAG polyprotein; MLV, A-minor K-turn, stem loop, b | 97.44 | |
| 1u6p_A | 56 | GAG polyprotein; MLV, A-minor K-turn, stem loop, b | 97.28 | |
| 2ysa_A | 55 | Retinoblastoma-binding protein 6; zinc finger, CCH | 97.19 | |
| 1a62_A | 130 | RHO; transcription termination, termination, RNA b | 96.97 | |
| 2ysa_A | 55 | Retinoblastoma-binding protein 6; zinc finger, CCH | 96.65 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 93.15 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 93.01 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 93.0 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 91.04 | |
| 2b8k_G | 215 | B16, DNA-directed RNA polymerase II 19 kDa polypep | 91.01 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 90.8 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 90.44 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 89.26 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 88.19 | |
| 2l55_A | 82 | SILB,silver efflux protein, MFP component of the c | 88.12 | |
| 1y14_B | 171 | B16, RPB7, DNA-directed RNA polymerase II 19 kDa p | 87.45 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 86.54 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 85.55 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 85.11 | |
| 2vb2_X | 88 | Copper protein, cation efflux system protein CUSF; | 85.02 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 84.44 | |
| 2qcp_X | 80 | Cation efflux system protein CUSF; silver-binding, | 84.35 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 82.15 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 80.97 | |
| 1luz_A | 88 | Protein K3, protein K2; stranded anti-parallel bet | 80.95 |
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.7e-37 Score=248.94 Aligned_cols=99 Identities=31% Similarity=0.583 Sum_probs=84.8
Q ss_pred CCccccceEEEEeeCCCceeEEecC-------CCCCceEEeccccccCCccccCCCCcEEEEEEeCCCccceeeccccCC
Q 047168 2 AQLTRSTGKVTWFDGAKGYGFIRPD-------DGGADLFVHQKSIKSDGYRTLYENQSVEFDVQLEADGKYQALDVTAPG 74 (258)
Q Consensus 2 ~~~~~~~G~vk~f~~~kGfGFI~~~-------~~~~dvF~H~s~l~~~~~~~l~~G~~V~F~v~~~~~G~~~A~~V~~~~ 74 (258)
.+.++++|+|||||.+||||||+++ ++++|||||+|+|...+|++|.+|++|+|+++.+++| ++|++|+.++
T Consensus 5 ~~l~~~~G~Vkwfn~~kGfGFI~~~~~~g~p~~~g~DvFvH~s~i~~~g~~~l~eG~~V~f~~~~g~kG-~~A~~V~~pg 83 (148)
T 3ts2_A 5 PQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKG-LESIRVTGPG 83 (148)
T ss_dssp -CCEEEEEEEEEEETTTTEEEEEEEEETTEEEEEEEEEEEEGGGBCSSSSCCCCTTCEEEEEEEEETTE-EEEEEEESGG
T ss_pred cccccceeEEEEEECCCCeeEEeeCccccccCCCCccEEEEhHHhcccCCccCCCCCEEEEEEEEcccc-chhhcccccC
Confidence 3567899999999999999999987 4679999999999999999999999999999999999 8999999999
Q ss_pred CCcccCCCCCCCCCCCCccCCCCCCCC
Q 047168 75 GAPVHSSKNNNTNNNSGYNNNRGGRGG 101 (258)
Q Consensus 75 g~~~~~s~~~~~g~~~c~~c~~~g~~~ 101 (258)
+++++++++++++...||||++.||++
T Consensus 84 g~pv~GS~rrp~~~~~C~~Cg~~GH~a 110 (148)
T 3ts2_A 84 GVFCIGSERRPKGGDRCYNCGGLDHHA 110 (148)
T ss_dssp GCCCCCCTTSCCCSCCCTTTCCSSCCG
T ss_pred CccccccccccCCCCcccEeCCccchh
Confidence 999999887775544455555444444
|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} SCOP: b.40.4.5 PDB: 2l15_A 1mjc_A 3mef_A | Back alignment and structure |
|---|
| >3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X | Back alignment and structure |
|---|
| >3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} | Back alignment and structure |
|---|
| >2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} | Back alignment and structure |
|---|
| >1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytv_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1dsq_A Nucleic acid binding protein P14; CCHC type zinc finger, virus/viral protein; NMR {Mouse mammary tumor virus} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A | Back alignment and structure |
|---|
| >1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A | Back alignment and structure |
|---|
| >1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A | Back alignment and structure |
|---|
| >1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A | Back alignment and structure |
|---|
| >2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a62_A RHO; transcription termination, termination, RNA binding domain, transcription regulation, OB fold, F1-ATPase; 1.55A {Escherichia coli BL21} SCOP: a.140.3.1 b.40.4.5 PDB: 1a63_A 2a8v_A 1a8v_A | Back alignment and structure |
|---|
| >2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2l55_A SILB,silver efflux protein, MFP component of the components proton antiporter metal...; APO form, AG(I)-binding site; NMR {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 | Back alignment and structure |
|---|
| >2vb2_X Copper protein, cation efflux system protein CUSF; cation PI, metal-binding, metal transport, copper tolerance, transport; 1.70A {Escherichia coli} PDB: 2vb3_X | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A | Back alignment and structure |
|---|
| >2qcp_X Cation efflux system protein CUSF; silver-binding, copper-binding, beta barrel, OB-fold, metall metal resistance, metal-binding; 1.00A {Escherichia coli str} PDB: 1zeq_X 3e6z_X | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 258 | ||||
| d1h95a_ | 79 | b.40.4.5 (A:) Y-box protein 1 cold shock domain (Y | 1e-22 | |
| d1mjca_ | 69 | b.40.4.5 (A:) Major cold shock protein {Escherichi | 3e-22 | |
| d1g6pa_ | 66 | b.40.4.5 (A:) Major cold shock protein {Thermotoga | 4e-18 | |
| d1c9oa_ | 66 | b.40.4.5 (A:) Major cold shock protein {Bacillus c | 2e-17 | |
| d1wfqa_ | 89 | b.40.4.5 (A:) Cold shock domain protein E1 (UNR) { | 1e-10 | |
| d2exfa1 | 42 | g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod | 7e-09 | |
| d2exfa1 | 42 | g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod | 7e-07 | |
| d2exfa1 | 42 | g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod | 9e-07 | |
| d2exfa1 | 42 | g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod | 1e-06 |
| >d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: Nucleic acid-binding proteins family: Cold shock DNA-binding domain-like domain: Y-box protein 1 cold shock domain (YB1-CSD) species: Human (Homo sapiens) [TaxId: 9606]
Score = 86.4 bits (214), Expect = 1e-22
Identities = 30/74 (40%), Positives = 44/74 (59%), Gaps = 5/74 (6%)
Query: 5 TRSTGKVTWFDGAKGYGFIRPDDGGADLFVHQKSIKSDG----YRTLYENQSVEFDVQLE 60
T+ G V WF+ GYGFI +D D+FVHQ +IK + R++ + ++VEFDV E
Sbjct: 7 TKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVV-E 65
Query: 61 ADGKYQALDVTAPG 74
+ +A +VT PG
Sbjct: 66 GEKGAEAANVTGPG 79
|
| >d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} Length = 69 | Back information, alignment and structure |
|---|
| >d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} Length = 66 | Back information, alignment and structure |
|---|
| >d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} Length = 66 | Back information, alignment and structure |
|---|
| >d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| d1mjca_ | 69 | Major cold shock protein {Escherichia coli [TaxId: | 99.91 | |
| d1h95a_ | 79 | Y-box protein 1 cold shock domain (YB1-CSD) {Human | 99.9 | |
| d1g6pa_ | 66 | Major cold shock protein {Thermotoga maritima [Tax | 99.88 | |
| d1c9oa_ | 66 | Major cold shock protein {Bacillus caldolyticus [T | 99.87 | |
| d1wfqa_ | 89 | Cold shock domain protein E1 (UNR) {Human (Homo sa | 99.72 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 99.42 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 99.18 | |
| d1nc8a_ | 29 | HIV nucleocapsid {Human immunodeficiency virus typ | 97.9 | |
| d2ix0a2 | 79 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 97.64 | |
| d1nc8a_ | 29 | HIV nucleocapsid {Human immunodeficiency virus typ | 97.59 | |
| d1a62a2 | 78 | Rho termination factor, RNA-binding domain {Escher | 96.79 | |
| d1dsqa_ | 26 | Nucleic acid binding protein p14 {Mouse mammary tu | 96.2 | |
| d1dsqa_ | 26 | Nucleic acid binding protein p14 {Mouse mammary tu | 96.2 | |
| d1a6bb_ | 40 | Zinc finger protein ncp10 {Moloney murine leukemia | 95.83 | |
| d1a6bb_ | 40 | Zinc finger protein ncp10 {Moloney murine leukemia | 95.12 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 93.9 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 90.57 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 90.44 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 90.14 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 89.34 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 89.1 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 88.62 | |
| d1u0la1 | 66 | Probable GTPase EngC (YjeQ), N-terminal domain {Th | 86.22 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 84.16 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 83.9 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 82.91 | |
| d2ix0a1 | 90 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 82.44 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 82.4 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 82.06 |
| >d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: Nucleic acid-binding proteins family: Cold shock DNA-binding domain-like domain: Major cold shock protein species: Escherichia coli [TaxId: 562]
Probab=99.91 E-value=9.7e-25 Score=152.99 Aligned_cols=68 Identities=47% Similarity=0.848 Sum_probs=64.7
Q ss_pred cccceEEEEeeCCCceeEEecCCCCCceEEeccccccCCccccCCCCcEEEEEEeCCCccceeeccccC
Q 047168 5 TRSTGKVTWFDGAKGYGFIRPDDGGADLFVHQKSIKSDGYRTLYENQSVEFDVQLEADGKYQALDVTAP 73 (258)
Q Consensus 5 ~~~~G~vk~f~~~kGfGFI~~~~~~~dvF~H~s~l~~~~~~~l~~G~~V~F~v~~~~~G~~~A~~V~~~ 73 (258)
.+++|+|||||.+||||||+++++++|||||+|+|...+++.|.+|++|+|++..+++| ++|++|+.+
T Consensus 2 ~r~~G~Vk~f~~~kGfGFI~~d~g~~diFvH~s~l~~~~~~~L~~G~~V~f~~~~~~~G-~~A~~V~~l 69 (69)
T d1mjca_ 2 GKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKG-PAAGNVTSL 69 (69)
T ss_dssp CCEEEEEEEEETTTTEEEEEETTSCCCEEEEGGGBCCTTTCCCCTTCEEEEEEECCSSS-CEEEEEEEC
T ss_pred CCEEEEEEEEeCCCCEEEEEEcCCCccEEEEhHHhcccCCCcCCCCCEEEEEEEeCCCC-cEEEEEEeC
Confidence 57999999999999999999999999999999999999999999999999999999999 899999864
|
| >d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} | Back information, alignment and structure |
|---|
| >d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} | Back information, alignment and structure |
|---|
| >d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} | Back information, alignment and structure |
|---|
| >d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0la1 b.40.4.5 (A:3-68) Probable GTPase EngC (YjeQ), N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ix0a1 b.40.4.5 (A:83-172) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|