Citrus Sinensis ID: 047188


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MNRHHDPNPFDEEEVNPFSNGPAAPASRSQVPSVTSEPIGFGQKYGATVDIPLDNMNEPKKKERELASWEADLKRREKEIKRREEAIVKAGVPTDDRNWPPFFPIIHHDISKEIPIHAQRLQYLAFASWFGIVLCLVFNVIAVIVCWIKGGGVKIFFLATIYALLGVPMSYVLWYRPLYRAMRTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLTGILAAIDVISDSLLAGIFYMIGFGLFVLESLLSLWVIQKIYMFFRGTSET
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
**RHHDPNPFDEEEVNP*********************************************************************IVKAGVPTDDRNWPPFFPIIHHDISKEIPIHAQRLQYLAFASWFGIVLCLVFNVIAVIVCWIKGGGVKIFFLATIYALLGVPMSYVLWYRPLYRAMRTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLTGILAAIDVISDSLLAGIFYMIGFGLFVLESLLSLWVIQKIYMFFRG****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRHHDPNPFDEEEVNPFSNGPAAPASRSQVPSVTSEPIGFGQKYGATVDIPLDNMNEPKKKERExxxxxxxxxxxxxxxxxxxxxIVKAGVPTDDRNWPPFFPIIHHDISKEIPIHAQRLQYLAFASWFGIVLCLVFNVIAVIVCWIKGGGVKIFFLATIYALLGVPMSYVLWYRPLYRAMRTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLTGILAAIDVISDSLLAGIFYMIGFGLFVLESLLSLWVIQKIYMFFRGTSET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Secretory carrier-associated membrane protein 4 Probably involved in membrane trafficking.confidentQ9C6X2
Secretory carrier-associated membrane protein 6 Probably involved in membrane trafficking.probableQ0JAI9
Putative secretory carrier-associated membrane protein 1 Probably involved in membrane trafficking.probableA2YMP7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NMD, chain A
Confidence level:probable
Coverage over the Query: 58-69
View the alignment between query and template
View the model in PyMOL