Citrus Sinensis ID: 047188

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-

MNRHHDPNPFDEEEVNPFSNGPAAPASRSQVPSVTSEPIGFGQKYGATVDIPLDNMNEPKKKERELASWEADLKRREKEIKRREEAIVKAGVPTDDRNWPPFFPIIHHDISKEIPIHAQRLQYLAFASWFGIVLCLVFNVIAVIVCWIKGGGVKIFFLATIYALLGVPMSYVLWYRPLYRAMRTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLTGILAAIDVISDSLLAGIFYMIGFGLFVLESLLSLWVIQKIYMFFRGTSET

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc

**RHHDPNPFDEEEVNP*********************************************************************IVKAGVPTDDRNWPPFFPIIHHDISKEIPIHAQRLQYLAFASWFGIVLCLVFNVIAVIVCWIKGGGVKIFFLATIYALLGVPMSYVLWYRPLYRAMRTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLTGILAAIDVISDSLLAGIFYMIGFGLFVLESLLSLWVIQKIYMFFRG****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNRHHDPNPFDEEEVNPFSNGPAAPASRSQVPSVTSEPIGFGQKYGATVDIPLDNMNEPKKKERExxxxxxxxxxxxxxxxxxxxxIVKAGVPTDDRNWPPFFPIIHHDISKEIPIHAQRLQYLAFASWFGIVLCLVFNVIAVIVCWIKGGGVKIFFLATIYALLGVPMSYVLWYRPLYRAMRTDSALKFSWFFLFYLIHIGFCIFAAIAPPVVFHGKSLTGILAAIDVISDSLLAGIFYMIGFGLFVLESLLSLWVIQKIYMFFRGTSET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Secretory carrier-associated membrane protein 4	Probably involved in membrane trafficking.	confident	Q9C6X2
Secretory carrier-associated membrane protein 6	Probably involved in membrane trafficking.	probable	Q0JAI9
Putative secretory carrier-associated membrane protein 1	Probably involved in membrane trafficking.	probable	A2YMP7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NMD, chain A
Confidence level:probable
Coverage over the Query: 58-69
View the alignment between query and template
View the model in PyMOL