Citrus Sinensis ID: 047211

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--

FSCKNIFHFSLSTVMEDQSQDANNNSPSRGSAERSTEPVRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGSVGDANVFYWFQNRRSRSRRRQRQLQASLAGEQRNNNIQQAQASSAAGAIQYEINSNCAAAALPMGFAATSPATFGSTPCTNFVAGSSSFCGVMGGDDGVETLYSVSGQMGFQEVVDQNSSVTSMLCPSESSNLQYQTGFITVFINGAPTEIPRGPIDMKALFGQDVVLVHSSGVPIPTNEFGFLMQSLQHGESYFLVSRPA

ccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccHHHHccccEEEEcccccccccccccccccccccccEEEEEEccc

********************************************PKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGSVGDANVFYWFQ***************************************************************************************VETLYSVSGQMGFQEVVD*******MLC*****NLQYQTGFITVFINGAPTEIPRGPIDMKALFGQDVVLVHSSGVPIPTNEFGFLMQSLQHGESYFLVSR**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
WUSCHEL-related homeobox 11	Transcription factor which may be involved in developmental processes.	probable	Q6X7J3
WUSCHEL-related homeobox 11	Transcription factor which may be involved in developmental processes.	probable	Q0D3I7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CUF, chain A
Confidence level:confident
Coverage over the Query: 43-104
View the alignment between query and template
View the model in PyMOL

Template: 1TYG, chain B
Confidence level:probable
Coverage over the Query: 222-279
View the alignment between query and template
View the model in PyMOL