Citrus Sinensis ID: 047211
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 282 | ||||||
| 255569408 | 261 | Protein WUSCHEL, putative [Ricinus commu | 0.897 | 0.969 | 0.702 | 3e-87 | |
| 224123922 | 255 | predicted protein [Populus trichocarpa] | 0.875 | 0.968 | 0.737 | 3e-84 | |
| 224144863 | 226 | predicted protein [Populus trichocarpa] | 0.794 | 0.991 | 0.631 | 6e-75 | |
| 359481008 | 236 | PREDICTED: WUSCHEL-related homeobox 11-l | 0.826 | 0.987 | 0.641 | 5e-73 | |
| 357508903 | 272 | WUSCHEL-related homeobox [Medicago trunc | 0.907 | 0.941 | 0.570 | 4e-64 | |
| 145338074 | 268 | WUSCHEL related homeobox 11 [Arabidopsis | 0.847 | 0.891 | 0.579 | 1e-63 | |
| 297811943 | 266 | predicted protein [Arabidopsis lyrata su | 0.897 | 0.951 | 0.540 | 2e-63 | |
| 388510020 | 272 | unknown [Medicago truncatula] | 0.907 | 0.941 | 0.567 | 2e-63 | |
| 37955223 | 268 | WOX11 protein [Arabidopsis thaliana] | 0.847 | 0.891 | 0.575 | 3e-63 | |
| 124360469 | 325 | Homeodomain-related [Medicago truncatula | 0.897 | 0.778 | 0.569 | 2e-62 |
| >gi|255569408|ref|XP_002525671.1| Protein WUSCHEL, putative [Ricinus communis] gi|223534971|gb|EEF36654.1| Protein WUSCHEL, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 327 bits (839), Expect = 3e-87, Method: Compositional matrix adjust.
Identities = 189/269 (70%), Positives = 214/269 (79%), Gaps = 16/269 (5%)
Query: 15 MEDQSQDANNNSPSRGSAERSTEPVRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRK 74
MED +NNSP ERS EPVRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRK
Sbjct: 1 MEDNQGQDSNNSPRNQGTERS-EPVRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRK 59
Query: 75 LLEKFGSVGDANVFYWFQNRRSRSRRRQRQLQASLAGEQRNNNIQQAQASSAAGAIQYEI 134
LLEKFGSVGDANVFYWFQNRRSRSRRRQRQ+QA+LA EQRN QQAQAS GAIQY+
Sbjct: 60 LLEKFGSVGDANVFYWFQNRRSRSRRRQRQMQATLAEEQRN---QQAQAS--GGAIQYDG 114
Query: 135 NSNCAAAALPMGFAATSPATFGSTPCTNFVAGSSSF-CGVM--GGDDGV-ETLYSVSGQM 190
S + +GFA +S + S FV GSS+ CG++ GG+DGV LYS+ QM
Sbjct: 115 GSTSS-----LGFANSSSFSAVSVSPPPFVVGSSTTSCGLVACGGEDGVANNLYSIPNQM 169
Query: 191 GFQEVVDQNSSVTSMLCPSESSNLQYQTGFITVFINGAPTEIPRGPIDMKALFGQDVVLV 250
GFQE + S ++S+LCP+E+SNL YQTGFITVFING PTE+PRGP+DMKA+FGQDVVLV
Sbjct: 170 GFQE-MGHTSGISSILCPTETSNLNYQTGFITVFINGVPTEVPRGPLDMKAMFGQDVVLV 228
Query: 251 HSSGVPIPTNEFGFLMQSLQHGESYFLVS 279
HSSG+P+PTNEFGFLM SLQHGESYFLV+
Sbjct: 229 HSSGMPVPTNEFGFLMHSLQHGESYFLVN 257
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224123922|ref|XP_002319197.1| predicted protein [Populus trichocarpa] gi|224123926|ref|XP_002319198.1| predicted protein [Populus trichocarpa] gi|222857573|gb|EEE95120.1| predicted protein [Populus trichocarpa] gi|222857574|gb|EEE95121.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224144863|ref|XP_002325442.1| predicted protein [Populus trichocarpa] gi|222862317|gb|EEE99823.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359481008|ref|XP_002269282.2| PREDICTED: WUSCHEL-related homeobox 11-like [Vitis vinifera] gi|296085887|emb|CBI31211.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357508903|ref|XP_003624740.1| WUSCHEL-related homeobox [Medicago truncatula] gi|217074296|gb|ACJ85508.1| unknown [Medicago truncatula] gi|355499755|gb|AES80958.1| WUSCHEL-related homeobox [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|145338074|ref|NP_187016.2| WUSCHEL related homeobox 11 [Arabidopsis thaliana] gi|342187324|sp|Q6X7J3.2|WOX11_ARATH RecName: Full=WUSCHEL-related homeobox 11 gi|332640447|gb|AEE73968.1| WUSCHEL related homeobox 11 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297811943|ref|XP_002873855.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297319692|gb|EFH50114.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|388510020|gb|AFK43076.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|37955223|gb|AAP37140.1| WOX11 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|124360469|gb|ABN08479.1| Homeodomain-related [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 282 | ||||||
| TAIR|locus:2096429 | 297 | WOX11 "AT3G03660" [Arabidopsis | 0.460 | 0.437 | 0.587 | 3.3e-65 | |
| TAIR|locus:2175941 | 268 | WOX12 "AT5G17810" [Arabidopsis | 0.900 | 0.947 | 0.468 | 1.1e-55 | |
| TAIR|locus:2057614 | 378 | HB-3 "homeobox-3" [Arabidopsis | 0.251 | 0.187 | 0.648 | 8.1e-36 | |
| TAIR|locus:2161353 | 325 | WOX8 "AT5G45980" [Arabidopsis | 0.319 | 0.276 | 0.505 | 2.4e-33 | |
| TAIR|locus:2060902 | 292 | WUS "AT2G17950" [Arabidopsis t | 0.269 | 0.260 | 0.410 | 3.3e-09 | |
| TAIR|locus:2166434 | 122 | WOX7 "AT5G05770" [Arabidopsis | 0.234 | 0.540 | 0.352 | 5.6e-08 | |
| TAIR|locus:2074638 | 182 | WOX5 "WUSCHEL related homeobox | 0.230 | 0.357 | 0.384 | 3.5e-07 | |
| TAIR|locus:2049547 | 271 | PFS2 "PRETTY FEW SEEDS 2" [Ara | 0.184 | 0.191 | 0.461 | 4.5e-07 | |
| UNIPROTKB|Q33DK1 | 203 | WOX3 "WUSCHEL-related homeobox | 0.187 | 0.261 | 0.452 | 4.9e-07 | |
| TAIR|locus:2088550 | 350 | WOX1 "WUSCHEL related homeobox | 0.301 | 0.242 | 0.305 | 6.6e-07 |
| TAIR|locus:2096429 WOX11 "AT3G03660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 378 (138.1 bits), Expect = 3.3e-65, Sum P(2) = 3.3e-65
Identities = 84/143 (58%), Positives = 104/143 (72%)
Query: 149 ATSPATFGSTPCTNFVAGSSSFCGVMGGDD-----GVETLYSVSGQMGFQEVVD---QN- 199
++SP++ S+ T+ A SSS G GG D G+E L ++SGQM + E QN
Sbjct: 155 SSSPSSCSSSSSTSSSASSSSSYG--GGCDNQSNSGMENLLTMSGQMSYHEATHHHYQNH 212
Query: 200 -SSVTSMLCPSE-SSNLQYQTGFITVFINGAPTEIPRGPIDMKALFGQDVVLVHSSGVPI 257
S+VTS+LCPS+ +SN QYQ G ITVFING PTE+ RG IDMKA FG+D+VLVHSSGVP+
Sbjct: 213 SSNVTSILCPSDQNSNFQYQQGAITVFINGVPTEVTRGGIDMKATFGEDLVLVHSSGVPL 272
Query: 258 PTNEFGFLMQSLQHGESYFLVSR 280
PT+EFGFLM SLQHGE+YFLV R
Sbjct: 273 PTDEFGFLMHSLQHGEAYFLVPR 295
|
|
| TAIR|locus:2175941 WOX12 "AT5G17810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057614 HB-3 "homeobox-3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161353 WOX8 "AT5G45980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2060902 WUS "AT2G17950" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166434 WOX7 "AT5G05770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074638 WOX5 "WUSCHEL related homeobox 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2049547 PFS2 "PRETTY FEW SEEDS 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q33DK1 WOX3 "WUSCHEL-related homeobox 3" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2088550 WOX1 "WUSCHEL related homeobox 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00130648 | SubName- Full=WOX11/12A protein; Flags- Fragment; (255 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 282 | |||
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 3e-11 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 2e-07 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 4e-07 | |
| COG5576 | 156 | COG5576, COG5576, Homeodomain-containing transcrip | 2e-04 |
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
Score = 57.1 bits (139), Expect = 3e-11
Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 5/61 (8%)
Query: 40 RSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGSVGDANVFYWFQNRRSRSR 99
R R T PEQ+ LE F P +E + K L + + V WFQNRR++ +
Sbjct: 2 RKRTTFTPEQLEELEKEFEKNR-YPSAEEREELAKKL----GLTERQVKVWFQNRRAKWK 56
Query: 100 R 100
R
Sbjct: 57 R 57
|
Length = 57 |
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
| >gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 282 | |||
| KOG0489 | 261 | consensus Transcription factor zerknullt and relat | 99.78 | |
| KOG0487 | 308 | consensus Transcription factor Abd-B, contains HOX | 99.77 | |
| KOG0488 | 309 | consensus Transcription factor BarH and related HO | 99.75 | |
| KOG0843 | 197 | consensus Transcription factor EMX1 and related HO | 99.75 | |
| KOG0842 | 307 | consensus Transcription factor tinman/NKX2-3, cont | 99.74 | |
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.67 | |
| KOG0485 | 268 | consensus Transcription factor NKX-5.1/HMX1, conta | 99.67 | |
| KOG0484 | 125 | consensus Transcription factor PHOX2/ARIX, contain | 99.66 | |
| KOG0848 | 317 | consensus Transcription factor Caudal, contains HO | 99.65 | |
| KOG0492 | 246 | consensus Transcription factor MSH, contains HOX d | 99.64 | |
| KOG0493 | 342 | consensus Transcription factor Engrailed, contains | 99.6 | |
| KOG2251 | 228 | consensus Homeobox transcription factor [Transcrip | 99.59 | |
| KOG0850 | 245 | consensus Transcription factor DLX and related pro | 99.59 | |
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.57 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 99.54 | |
| KOG0494 | 332 | consensus Transcription factor CHX10 and related H | 99.54 | |
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 99.53 | |
| KOG0483 | 198 | consensus Transcription factor HEX, contains HOX a | 99.51 | |
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.5 | |
| KOG0844 | 408 | consensus Transcription factor EVX1, contains HOX | 99.49 | |
| KOG4577 | 383 | consensus Transcription factor LIM3, contains LIM | 99.48 | |
| KOG3802 | 398 | consensus Transcription factor OCT-1, contains POU | 99.41 | |
| KOG0491 | 194 | consensus Transcription factor BSH, contains HOX d | 99.4 | |
| KOG0486 | 351 | consensus Transcription factor PTX1, contains HOX | 99.4 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 99.28 | |
| KOG0847 | 288 | consensus Transcription factor, contains HOX domai | 99.25 | |
| KOG0849 | 354 | consensus Transcription factor PRD and related pro | 99.06 | |
| KOG1168 | 385 | consensus Transcription factor ACJ6/BRN-3, contain | 98.92 | |
| KOG2252 | 558 | consensus CCAAT displacement protein and related h | 98.2 | |
| KOG0775 | 304 | consensus Transcription factor SIX and related HOX | 98.2 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 98.19 | |
| KOG0774 | 334 | consensus Transcription factor PBX and related HOX | 97.66 | |
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 97.46 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 97.15 | |
| KOG0773 | 342 | consensus Transcription factor MEIS1 and related H | 95.7 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 95.12 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 90.45 | |
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 90.44 | |
| PRK08053 | 66 | sulfur carrier protein ThiS; Provisional | 85.48 | |
| PRK07696 | 67 | sulfur carrier protein ThiS; Provisional | 80.42 |
| >KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.78 E-value=2.4e-20 Score=171.15 Aligned_cols=68 Identities=22% Similarity=0.350 Sum_probs=61.4
Q ss_pred CCCCCCCCCCCHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHhcCCCCCCceeecccccchhhHHHHHHHHHh
Q 047211 36 TEPVRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGSVGDANVFYWFQNRRSRSRRRQRQLQAS 108 (282)
Q Consensus 36 ~~~kR~Rt~fT~eQL~~LE~~F~~~~~yP~~~eR~~Ia~eLa~~~~Lse~qVkvWFQNRRAK~KRk~r~~q~~ 108 (282)
+..||.|+.||..||.+||++|..|+ |..+.+|.+||..| .|+|+||||||||||+||||+.+.....
T Consensus 157 ~~~kR~RtayT~~QllELEkEFhfN~-YLtR~RRiEiA~~L----~LtErQIKIWFQNRRMK~Kk~~k~~~~~ 224 (261)
T KOG0489|consen 157 GKSKRRRTAFTRYQLLELEKEFHFNK-YLTRSRRIEIAHAL----NLTERQIKIWFQNRRMKWKKENKAKSSQ 224 (261)
T ss_pred CCCCCCCcccchhhhhhhhhhhcccc-ccchHHHHHHHhhc----chhHHHHHHHHHHHHHHHHHhhcccccc
Confidence 34689999999999999999999999 59999999888888 7999999999999999999988776543
|
|
| >KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG0485 consensus Transcription factor NKX-5 | Back alignment and domain information |
|---|
| >KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2251 consensus Homeobox transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0847 consensus Transcription factor, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >PRK08053 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PRK07696 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 282 | |||
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 1e-09 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 1e-06 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 2e-06 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 3e-06 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 4e-06 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 6e-06 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 1e-05 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 2e-05 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 3e-05 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 4e-05 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 5e-05 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 7e-05 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 8e-05 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 9e-05 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 9e-05 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 2e-04 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 3e-04 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 4e-04 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 5e-04 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 5e-04 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 6e-04 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 9e-04 |
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
Score = 53.5 bits (128), Expect = 1e-09
Identities = 23/84 (27%), Positives = 33/84 (39%), Gaps = 12/84 (14%)
Query: 30 GSAERSTEPVRSRWTPKPEQILILESIFNSG----------MVNPPKDETVRIRKLLEKF 79
GS+ S SR+T + E + ++ES FN + N + K L
Sbjct: 1 GSSGSSGR--GSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDL 58
Query: 80 GSVGDANVFYWFQNRRSRSRRRQR 103
V V+ WF NRR +RR
Sbjct: 59 ERVTSLKVYNWFANRRKEIKRRAN 82
|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 282 | |||
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.83 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.82 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.82 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.82 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.81 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.81 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.81 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.81 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.81 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.81 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.81 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.8 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.8 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.8 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.8 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.8 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.8 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.8 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.79 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 99.79 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.79 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 99.79 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.79 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.79 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.78 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.78 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.78 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.78 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.78 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.78 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.78 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 99.78 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 99.77 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 99.77 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.77 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 99.77 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 99.77 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 99.77 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 99.76 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 99.76 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.76 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.76 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 99.75 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.75 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 99.75 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.74 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 99.74 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 99.74 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 99.73 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 99.73 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 99.72 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 99.72 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 99.72 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 99.72 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 99.71 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 99.71 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 99.7 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 99.7 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 99.69 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 99.69 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.69 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.69 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.68 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 99.68 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 99.67 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 99.67 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 99.66 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 99.65 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 99.64 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.64 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.61 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 99.54 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 99.51 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 99.41 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 99.38 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 99.34 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 99.29 | |
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 98.84 | |
| 1tyg_B | 87 | YJBS; alpha beta barrel, protein-protein complex, | 81.5 | |
| 2ys9_A | 70 | Homeobox and leucine zipper protein homez; homeodo | 81.04 |
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
Probab=99.83 E-value=2.8e-21 Score=146.41 Aligned_cols=70 Identities=26% Similarity=0.363 Sum_probs=61.1
Q ss_pred CCCCCCCCCCCCCHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHhcCCCCCCceeecccccchhhHHHHHHHHHh
Q 047211 34 RSTEPVRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGSVGDANVFYWFQNRRSRSRRRQRQLQAS 108 (282)
Q Consensus 34 ~~~~~kR~Rt~fT~eQL~~LE~~F~~~~~yP~~~eR~~Ia~eLa~~~~Lse~qVkvWFQNRRAK~KRk~r~~q~~ 108 (282)
..+.++|+|+.||++|+.+||.+|..++ ||+..+|.+||.+| +|++++|++||||||+|+|++++..++.
T Consensus 3 ~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~-yp~~~~r~~LA~~l----~l~~~qV~vWFqNRR~k~kk~~~~~~~~ 72 (80)
T 2cue_A 3 SGSSGQRNRTSFTQEQIEALEKEFERTH-YPDVFARERLAAKI----DLPEARIQVWFSNRRAKWRREEKLRNQR 72 (80)
T ss_dssp SCCSSCCCCCCSCHHHHHHHHHHHTTCS-SCCHHHHHHHHHHT----TCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CCCCCCCCCCccCHHHHHHHHHHHhccC-CCCHHHHHHHHHHh----CCCHHHhhHHHHHHHHHHHHHhhhhhcc
Confidence 3456788999999999999999999998 59999887666666 8999999999999999999998776543
|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
| >1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 282 | ||||
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 8e-10 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 5e-09 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 6e-09 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 3e-08 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 8e-08 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 2e-07 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 2e-07 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 3e-07 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 3e-07 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 6e-07 | |
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 8e-07 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 1e-06 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 2e-06 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 3e-06 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 3e-06 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 6e-06 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 6e-06 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 9e-06 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 1e-05 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 2e-05 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 4e-05 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 5e-05 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 1e-04 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 2e-04 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 3e-04 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 4e-04 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 8e-04 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 9e-04 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 0.001 |
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Insulin gene enhancer protein isl-1 species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 51.8 bits (124), Expect = 8e-10
Identities = 10/67 (14%), Positives = 25/67 (37%), Gaps = 5/67 (7%)
Query: 40 RSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGSVGDANVFYWFQNRRSRSR 99
R R +Q+ L + + + + + + + WFQN+R + +
Sbjct: 5 RVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMT-----GLSPRVIRVWFQNKRCKDK 59
Query: 100 RRQRQLQ 106
+R ++
Sbjct: 60 KRSIMMK 66
|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 282 | |||
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.84 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.84 | |
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.83 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.83 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.83 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.83 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.83 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.82 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.82 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.82 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.81 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.81 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.8 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.8 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.8 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.79 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.79 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.77 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.75 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.75 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.75 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.72 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.72 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.71 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.7 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.67 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.66 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.65 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.61 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 99.56 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 99.54 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 99.51 | |
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 81.91 |
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeotic bicoid protein species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.84 E-value=2e-22 Score=148.85 Aligned_cols=62 Identities=34% Similarity=0.457 Sum_probs=56.8
Q ss_pred CCCCCCCCCHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHhcCCCCCCceeecccccchhhHHHHHH
Q 047211 38 PVRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGSVGDANVFYWFQNRRSRSRRRQRQ 104 (282)
Q Consensus 38 ~kR~Rt~fT~eQL~~LE~~F~~~~~yP~~~eR~~Ia~eLa~~~~Lse~qVkvWFQNRRAK~KRk~r~ 104 (282)
|+|+|+.||++|+.+||.+|+.++ ||+.++|.+||+.| ||++++|+|||||||+|+|+...+
T Consensus 1 Prr~Rt~ft~~Ql~~Le~~F~~~~-yp~~~~r~~LA~~l----~l~~~~V~iWFqNrR~k~kk~~~~ 62 (67)
T d1zq3p1 1 PRRTRTTFTSSQIAELEQHFLQGR-YLTAPRLADLSAKL----ALGTAQVKIWFKNRRRRHKIQSDQ 62 (67)
T ss_dssp CSCCSCCCCHHHHHHHHHHHTTCS-SCCHHHHHHHHHHH----TSCHHHHHHHHHHHHHHHHHHHHT
T ss_pred CCCCCCcCCHHHHHHHHHHHHHCC-CCCHHHHHHHHHHh----CCCccceeeccccHHHhHhhhhhh
Confidence 578999999999999999999999 59999998888887 799999999999999999987654
|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|