Citrus Sinensis ID: 047228

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
PNWHNTKHDSVFLIFLSVPISFKHPHTHFCQLRHVTCCNNLNTLNIPLSIFVPRPLRRERKAVIFRYREKQIRRFGHYSIQILLVVDFCYSKQSMVMTVAYPKKAVSLTEKVLQRVYGNHSTSSSSNLGCSFDSDDDNEEDGESTVELMQIGAERTKNVLILMSDTGGGHRASAEAIRDAFKIEFGDEYRIFVKDVCKEYAGWPLNDMERSYKFMVKHVQLWKVAFHSTSPKWIHSCYLAAMAAYYAKEVEAGLMEYKPDIIISVHPLMQHIPLWVLKWQ
cccccccccCEEEEEEEccccccccccccccccccccccccccccccCEEEccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHcHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHcccc
******KHDSVFLIFLSVPISFKHPHTHFCQLRHVTCCNNLNTLNIPLSIFVPRPLRRERKAVIFRYREKQIRRFGHYSIQILLVVDFCYSKQSMVMTVAYPKKAVSLTEKVLQRVYG************************************RTKNVLILMSDTGGGHRASAEAIRDAFKIEFGDEYRIFVKDVCKEYAGWPLNDMERSYKFMVKHVQLWKVAFHSTSPKWIHSCYLAAMAAYYAKEVEAGLMEYKPDIIISVHPLMQHIPLWVLKW*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PNWHNTKHDSVFLIFLSVPISFKHPHTHFCQLRHVTCCNNLNTLNIPLSIFVPRPLRRERKAVIFRYREKQIRRFGHYSIQILLVVDFCYSKQSMVMTVAYPKKAVSLTEKVLQRVYGNHSTSSSSNLGCSFDSDDDNEEDGESTVELMQIGAERTKNVLILMSDTGGGHRASAEAIRDAFKIEFGDEYRIFVKDVCKEYAGWPLNDMERSYKFMVKHVQLWKVAFHSTSPKWIHSCYLAAMAAYYAKEVEAGLMEYKPDIIISVHPLMQHIPLWVLKWQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable monogalactosyldiacylglycerol synthase 3, chloroplastic Involved in the synthesis of the major structural component of photosynthetic membranes.probableQ0DWQ1
Monogalactosyldiacylglycerol synthase 2, chloroplastic Involved in the synthesis of the major structural component of photosynthetic membranes and in the chloroplast envelope biogenesis. Can use both prokaryotic (18:1/16:0) or eukaryotic (18:2/18:2) 1,2-diacylglycerol species, but operates with some preference for the eukaryotic one.probableO82730

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GEK, chain A
Confidence level:probable
Coverage over the Query: 157-217,242-276
View the alignment between query and template
View the model in PyMOL