Citrus Sinensis ID: 047241


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MDEEPRGEVKYRGVRRRPWGKFAAEIRDSNRHGQRVWLGTFNTAEEAARAYDRAAYSMRGHLAILNFPHEYPRASHQGTSASLGSSSTGSSSTGSSSSSMPGNVENQSEESGRGKQVIELEYLDDNLLDELLEQEEKRNKKG
ccccccccccccccccccccccHHHHccccccccEEEEcccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccHHHHHHHHHccccccccc
*************VRRRPWGKFAAEIRDSNRHGQRVWLGTFNTAEEAARAYDRAAYSMRGHLAILNFPH************************************************IELEYLDDNLLDE************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEEPRGEVKYRGVRRRPWGKFAAEIRDSNRHGQRVWLGTFNTAEEAARAYDRAAYSMRGHLAILNFPHEYPRASHQGTSASLGSSSTGSSSTGSSSSSMPGNVENQSEESGRGKQVIELEYLDDNLLDELLEQEEKRNKKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ethylene-responsive transcription factor ERF098 Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.probableQ9LTC5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 10-70
View the alignment between query and template
View the model in PyMOL