Citrus Sinensis ID: 047244
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 125 | ||||||
| 147860501 | 625 | hypothetical protein VITISV_016437 [Viti | 0.928 | 0.185 | 0.632 | 1e-35 | |
| 356528060 | 666 | PREDICTED: L-type lectin-domain containi | 0.936 | 0.175 | 0.571 | 9e-30 | |
| 296081486 | 531 | unnamed protein product [Vitis vinifera] | 0.648 | 0.152 | 0.682 | 2e-26 | |
| 225439478 | 680 | PREDICTED: L-type lectin-domain containi | 0.968 | 0.177 | 0.447 | 3e-21 | |
| 225439476 | 672 | PREDICTED: L-type lectin-domain containi | 0.976 | 0.181 | 0.435 | 4e-20 | |
| 255558978 | 662 | kinase, putative [Ricinus communis] gi|2 | 0.936 | 0.176 | 0.453 | 4e-20 | |
| 359481749 | 1258 | PREDICTED: L-type lectin-domain containi | 0.824 | 0.081 | 0.490 | 2e-19 | |
| 297841745 | 633 | lectin protein kinase family protein [Ar | 0.936 | 0.184 | 0.406 | 8e-19 | |
| 255584540 | 683 | kinase, putative [Ricinus communis] gi|2 | 0.968 | 0.177 | 0.439 | 9e-19 | |
| 225448524 | 695 | PREDICTED: L-type lectin-domain containi | 0.92 | 0.165 | 0.4 | 1e-18 |
| >gi|147860501|emb|CAN83975.1| hypothetical protein VITISV_016437 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 153 bits (387), Expect = 1e-35, Method: Compositional matrix adjust.
Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 1/117 (0%)
Query: 1 ILISSLIPSASEPAYYYSRNNHRIPILLRSGDPIRAWVDYSSQEMLIKVSKSPLGVPKPR 60
I ISSLI + S+PA YY NN I +SGDPI+AW++Y+SQE L+ V+ SPLG+PK
Sbjct: 157 IDISSLISNVSKPAAYYFTNNSNNSIAFKSGDPIQAWIEYNSQEQLMNVTISPLGIPKSF 216
Query: 61 RPLISFPIDLSLVLDEYMYRGFSASTGLITASHNVHGWSISIGGGKAQDLNPTKVPT 117
RPLISFPIDLS+VL+EYM+ GFSASTGL+TA+HNVHGWS I GG+A DL+P ++P+
Sbjct: 217 RPLISFPIDLSMVLNEYMHIGFSASTGLLTAAHNVHGWSFRI-GGRAADLDPLRLPS 272
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356528060|ref|XP_003532623.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296081486|emb|CBI20009.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225439478|ref|XP_002267692.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225439476|ref|XP_002267597.1| PREDICTED: L-type lectin-domain containing receptor kinase S.4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255558978|ref|XP_002520512.1| kinase, putative [Ricinus communis] gi|223540354|gb|EEF41925.1| kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359481749|ref|XP_003632669.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297841745|ref|XP_002888754.1| lectin protein kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297334595|gb|EFH65013.1| lectin protein kinase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255584540|ref|XP_002532997.1| kinase, putative [Ricinus communis] gi|223527226|gb|EEF29389.1| kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225448524|ref|XP_002273348.1| PREDICTED: L-type lectin-domain containing receptor kinase V.9-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 125 | ||||||
| TAIR|locus:2043127 | 623 | AT2G29250 [Arabidopsis thalian | 0.92 | 0.184 | 0.435 | 9e-20 | |
| TAIR|locus:2025037 | 258 | AT1G07460 [Arabidopsis thalian | 0.92 | 0.445 | 0.427 | 5.1e-19 | |
| TAIR|locus:2043162 | 627 | AT2G29220 [Arabidopsis thalian | 0.92 | 0.183 | 0.410 | 2.3e-18 | |
| TAIR|locus:2020608 | 666 | AT1G70110 [Arabidopsis thalian | 0.936 | 0.175 | 0.389 | 5.4e-18 | |
| TAIR|locus:2099941 | 684 | AT3G55550 [Arabidopsis thalian | 0.952 | 0.173 | 0.403 | 2.5e-17 | |
| TAIR|locus:2078337 | 664 | AT3G45410 [Arabidopsis thalian | 0.976 | 0.183 | 0.382 | 1.7e-16 | |
| TAIR|locus:2085587 | 669 | AT3G45440 [Arabidopsis thalian | 0.944 | 0.176 | 0.377 | 5.6e-15 | |
| TAIR|locus:2144025 | 657 | AT5G60280 [Arabidopsis thalian | 0.944 | 0.179 | 0.380 | 7e-15 | |
| TAIR|locus:2078332 | 682 | AT3G45330 [Arabidopsis thalian | 0.912 | 0.167 | 0.364 | 9.5e-15 | |
| TAIR|locus:2133239 | 669 | AT4G02420 [Arabidopsis thalian | 0.92 | 0.171 | 0.405 | 1.5e-14 |
| TAIR|locus:2043127 AT2G29250 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 244 (91.0 bits), Expect = 9.0e-20, P = 9.0e-20
Identities = 51/117 (43%), Positives = 76/117 (64%)
Query: 3 ISSLIPSASEPAYYYS-RNNHRIPILLRSGDPIRAWVDYSSQEMLIKVSKSPLGVPKPRR 61
++ +I S A Y+ R I + L SG PIR W++Y++ E ++ V+ +PL PKP+
Sbjct: 163 LNGVISIESTSAEYFDDREAKNISLRLASGKPIRVWIEYNATETMLNVTLAPLDRPKPKL 222
Query: 62 PLISFPIDLSLVLDEYMYRGFSASTGLITASHNVHGWSISIGGGKAQDLNPTKVPTL 118
PL+S ++LS ++ E Y GFSA+TG +T+SH V GWS SI G KA D + TK+P+L
Sbjct: 223 PLLSRKLNLSGIISEENYVGFSAATGTVTSSHFVLGWSFSIEG-KASDFDITKLPSL 278
|
|
| TAIR|locus:2025037 AT1G07460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043162 AT2G29220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020608 AT1G70110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099941 AT3G55550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078337 AT3G45410 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085587 AT3G45440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2144025 AT5G60280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078332 AT3G45330 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133239 AT4G02420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00031525001 | SubName- Full=Chromosome chr12 scaffold_57, whole genome shotgun sequence; (647 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 125 | |||
| cd06899 | 236 | cd06899, lectin_legume_LecRK_Arcelin_ConA, legume | 2e-31 | |
| pfam00139 | 231 | pfam00139, Lectin_legB, Legume lectin domain | 7e-28 | |
| cd01951 | 223 | cd01951, lectin_L-type, legume lectins | 2e-06 |
| >gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor | Back alignment and domain information |
|---|
Score = 110 bits (278), Expect = 2e-31
Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 7/104 (6%)
Query: 1 ILISSLIPSASEPAYYYSRNNHRIPILLRSGDPIRAWVDYSSQEMLIKVSKSPLGVPKPR 60
I ++SL+ S A Y+ + + L+SG P++AW+DY S + V+ + GV KP+
Sbjct: 140 IDVNSLV---SVKAGYWDDDGGK----LKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPK 192
Query: 61 RPLISFPIDLSLVLDEYMYRGFSASTGLITASHNVHGWSISIGG 104
+PL+S+P+DLS VL E +Y GFSASTGL+T H + WS S G
Sbjct: 193 KPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSNG 236
|
This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236 |
| >gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain | Back alignment and domain information |
|---|
| >gnl|CDD|173886 cd01951, lectin_L-type, legume lectins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 125 | |||
| cd06899 | 236 | lectin_legume_LecRK_Arcelin_ConA legume lectins, l | 99.93 | |
| PF00139 | 236 | Lectin_legB: Legume lectin domain; InterPro: IPR00 | 99.89 | |
| cd01951 | 223 | lectin_L-type legume lectins. The L-type (legume-t | 99.74 | |
| cd07308 | 218 | lectin_leg-like legume-like lectins: ERGIC-53, ERG | 98.41 | |
| cd06902 | 225 | lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran | 98.1 | |
| cd06903 | 215 | lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem | 97.1 | |
| PF03388 | 229 | Lectin_leg-like: Legume-like lectin family; InterP | 96.8 | |
| cd06901 | 248 | lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr | 96.64 | |
| KOG3838 | 497 | consensus Mannose lectin ERGIC-53, involved in gly | 95.72 | |
| KOG3839 | 351 | consensus Lectin VIP36, involved in the transport | 91.28 | |
| cd06900 | 255 | lectin_VcfQ VcfQ bacterial pilus biogenesis protei | 89.44 |
| >cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.5e-25 Score=173.53 Aligned_cols=96 Identities=43% Similarity=0.670 Sum_probs=87.1
Q ss_pred CccCCccccceeecCcccCCCCccceeecCCCcEEEEEEEcCCCCEEEEEEEeCCCCCCCCceeeeeecCCccCCCeeeE
Q 047244 1 ILISSLIPSASEPAYYYSRNNHRIPILLRSGDPIRAWVDYSSQEMLIKVSKSPLGVPKPRRPLISFPIDLSLVLDEYMYR 80 (125)
Q Consensus 1 IdiNsv~S~~t~~~~~~~~~~~~~~~~l~~G~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~ls~~vdLs~~L~e~v~V 80 (125)
||||++.|..+..+.. ..+.|.+|+.++|||+||+.+++|+|+|...+..+|..|+|+..+||+++|+++|||
T Consensus 140 Idvn~~~S~~~~~~~~-------~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~ls~~vdL~~~l~~~~~v 212 (236)
T cd06899 140 IDVNSLVSVKAGYWDD-------DGGKLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYV 212 (236)
T ss_pred EEcCCcccceeecccc-------ccccccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCCcCCEEEEeccHHHhCCCceEE
Confidence 6899998888877652 245578999999999999999999999998876688899999999999999999999
Q ss_pred EEEeecCCceeeeEEEeEEEEeC
Q 047244 81 GFSASTGLITASHNVHGWSISIG 103 (125)
Q Consensus 81 GFSAsTG~~~e~h~i~sWsF~~~ 103 (125)
||||+||...|.|+|++|+|+++
T Consensus 213 GFSasTG~~~~~h~i~sWsF~s~ 235 (236)
T cd06899 213 GFSASTGLLTELHYILSWSFSSN 235 (236)
T ss_pred EEEeEcCCCcceEEEEEEEEEcC
Confidence 99999999999999999999875
|
This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin |
| >PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported | Back alignment and domain information |
|---|
| >cd01951 lectin_L-type legume lectins | Back alignment and domain information |
|---|
| >cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 | Back alignment and domain information |
|---|
| >cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates | Back alignment and domain information |
|---|
| >cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain | Back alignment and domain information |
|---|
| >KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 125 | |||
| 1qmo_E | 133 | Mannose binding lectin, FRIL; crosslink, hematopoi | 4e-18 | |
| 1hql_A | 257 | Lectin; xenograft antigen, sugar BI protein; HET: | 6e-17 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 2e-16 | |
| 3zyr_A | 261 | Lectin; sugar binding protein, N-glycan; HET: NAG | 2e-16 | |
| 1v6i_A | 232 | Agglutinin, PNA, galactose-binding lectin; open qu | 2e-16 | |
| 1avb_A | 226 | Arcelin-1; lectin-like glycoprotein, plant defense | 3e-16 | |
| 2fmd_A | 240 | Lectin, agglutinin, BMA; legume lectin, beta sandw | 4e-16 | |
| 1fny_A | 237 | BARK lectin, BARK agglutinin I,polypeptide A; legu | 2e-15 | |
| 1fat_A | 252 | Phytohemagglutinin-L; glycoprotein, plant defense | 5e-15 | |
| 1dhk_B | 223 | Bean lectin-like inhibitor, porcine pancreatic alp | 6e-15 | |
| 1wbf_A | 242 | Protein (agglutinin); lectin (agglutinin), legume | 9e-15 | |
| 2bqp_A | 234 | Protein (PEA lectin); D-glucopyranose complex, sug | 9e-15 | |
| 1gzc_A | 239 | Erythrina crista-galli lectin; carbohydrate, sugar | 1e-14 | |
| 1gsl_A | 243 | Griffonia simplicifolia lectin 4; glycoprotein, ma | 1e-14 | |
| 1ioa_A | 240 | Arcelin-5A, ARC5A; lectin-like proteins, plant def | 2e-14 | |
| 1sbf_A | 253 | Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G | 3e-14 | |
| 1n47_A | 233 | Isolectin B4; cancer antigen, vicia villosa lectin | 4e-14 | |
| 3ipv_A | 251 | Lectin alpha chain; galactose binding, SEED lectin | 5e-14 | |
| 1g7y_A | 253 | Stem/LEAF lectin DB58; jelly roll fold, sugar bind | 6e-14 | |
| 2eig_A | 234 | Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin | 2e-13 | |
| 1fx5_A | 242 | UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO | 3e-13 | |
| 1f9k_A | 238 | Acidic lectin; legume lectin, glycosylated protein | 4e-13 | |
| 1dbn_A | 239 | MAL, protein (leukoagglutinin); plant lectin, carb | 8e-13 | |
| 1qnw_A | 242 | Chitin binding lectin, UEA-II; carbohydrate bindin | 1e-12 | |
| 2ltn_B | 52 | PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP | 3e-09 | |
| 1gv9_A | 260 | P58/ergic-53; lectin, carbohydrate binding; 1.46A | 7e-04 |
| >1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 | Back alignment and structure |
|---|
Score = 73.6 bits (180), Expect = 4e-18
Identities = 25/107 (23%), Positives = 42/107 (39%), Gaps = 9/107 (8%)
Query: 19 RNNHRIPILLRSGDPIRAWVDYSSQEMLIKVSKSPLGVPKPRRPLISFPIDLSLVLDEYM 78
R+ ++G A + Y+S + V+ + +S+ I+L VL E++
Sbjct: 32 RSKVTAKWDWQNGKIATAHISYNSVSKRLSVT---SYYAGSKPATLSYDIELHTVLPEWV 88
Query: 79 YRGFSASTGLITASHNVHGWSISIGGGKAQDLNPTKVPTLEKKKKIS 125
G SASTG + VH WS + L + K I+
Sbjct: 89 RVGLSASTGQDKERNTVHSWSFT------SSLWTNVAKKENENKYIT 129
|
| >1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 | Back alignment and structure |
|---|
| >3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 | Back alignment and structure |
|---|
| >1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 | Back alignment and structure |
|---|
| >1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 | Back alignment and structure |
|---|
| >2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 | Back alignment and structure |
|---|
| >1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 | Back alignment and structure |
|---|
| >1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 | Back alignment and structure |
|---|
| >1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 | Back alignment and structure |
|---|
| >1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 | Back alignment and structure |
|---|
| >2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 | Back alignment and structure |
|---|
| >1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 | Back alignment and structure |
|---|
| >1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 | Back alignment and structure |
|---|
| >1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 | Back alignment and structure |
|---|
| >1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 | Back alignment and structure |
|---|
| >1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 | Back alignment and structure |
|---|
| >3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 | Back alignment and structure |
|---|
| >1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 | Back alignment and structure |
|---|
| >2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 | Back alignment and structure |
|---|
| >1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 | Back alignment and structure |
|---|
| >1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 | Back alignment and structure |
|---|
| >1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 | Back alignment and structure |
|---|
| >1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 | Back alignment and structure |
|---|
| >2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 | Back alignment and structure |
|---|
| >1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 125 | |||
| 1qmo_E | 133 | Mannose binding lectin, FRIL; crosslink, hematopoi | 99.97 | |
| 1hql_A | 257 | Lectin; xenograft antigen, sugar BI protein; HET: | 99.96 | |
| 3ipv_A | 251 | Lectin alpha chain; galactose binding, SEED lectin | 99.95 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 99.95 | |
| 3ujo_A | 281 | Legume lectin; carbohydrate-binding, galactose, ad | 99.95 | |
| 3zyr_A | 261 | Lectin; sugar binding protein, N-glycan; HET: NAG | 99.95 | |
| 1ioa_A | 240 | Arcelin-5A, ARC5A; lectin-like proteins, plant def | 99.94 | |
| 1avb_A | 226 | Arcelin-1; lectin-like glycoprotein, plant defense | 99.94 | |
| 1dhk_B | 223 | Bean lectin-like inhibitor, porcine pancreatic alp | 99.94 | |
| 2bqp_A | 234 | Protein (PEA lectin); D-glucopyranose complex, sug | 99.94 | |
| 1dbn_A | 239 | MAL, protein (leukoagglutinin); plant lectin, carb | 99.94 | |
| 1fny_A | 237 | BARK lectin, BARK agglutinin I,polypeptide A; legu | 99.94 | |
| 2eig_A | 234 | Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin | 99.94 | |
| 1fx5_A | 242 | UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO | 99.94 | |
| 1gzc_A | 239 | Erythrina crista-galli lectin; carbohydrate, sugar | 99.94 | |
| 1qnw_A | 242 | Chitin binding lectin, UEA-II; carbohydrate bindin | 99.94 | |
| 1n47_A | 233 | Isolectin B4; cancer antigen, vicia villosa lectin | 99.94 | |
| 1sbf_A | 253 | Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G | 99.94 | |
| 1g7y_A | 253 | Stem/LEAF lectin DB58; jelly roll fold, sugar bind | 99.93 | |
| 1f9k_A | 238 | Acidic lectin; legume lectin, glycosylated protein | 99.93 | |
| 1wbf_A | 242 | Protein (agglutinin); lectin (agglutinin), legume | 99.93 | |
| 1fat_A | 252 | Phytohemagglutinin-L; glycoprotein, plant defense | 99.93 | |
| 1v6i_A | 232 | Agglutinin, PNA, galactose-binding lectin; open qu | 99.93 | |
| 2fmd_A | 240 | Lectin, agglutinin, BMA; legume lectin, beta sandw | 99.93 | |
| 1gsl_A | 243 | Griffonia simplicifolia lectin 4; glycoprotein, ma | 99.93 | |
| 2ltn_B | 52 | PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP | 99.74 | |
| 1gv9_A | 260 | P58/ergic-53; lectin, carbohydrate binding; 1.46A | 99.66 | |
| 2dur_A | 253 | VIP36;, vesicular integral-membrane protein VIP36; | 99.64 | |
| 2a6y_A | 256 | EMP47P (FORM1); beta sandwich, carbohydrate bindin | 99.23 | |
| 2ltn_A | 181 | PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO | 98.96 | |
| 2a6z_A | 222 | EMP47P (FORM2); beta sandwich, carbohydrate bindin | 98.18 | |
| 2a6v_A | 226 | EMP46P; beta sandwich, carbohydrate binding protei | 96.99 |
| >1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 | Back alignment and structure |
|---|
Probab=99.97 E-value=3.7e-30 Score=184.15 Aligned_cols=89 Identities=28% Similarity=0.375 Sum_probs=82.2
Q ss_pred CccCCccccceeecCcccCCCCccceeecCCCcEEEEEEEcCCCCEEEEEEEeCCCCCCCCceeeeeecCCccCCCeeeE
Q 047244 1 ILISSLIPSASEPAYYYSRNNHRIPILLRSGDPIRAWVDYSSQEMLIKVSKSPLGVPKPRRPLISFPIDLSLVLDEYMYR 80 (125)
Q Consensus 1 IdiNsv~S~~t~~~~~~~~~~~~~~~~l~~G~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~ls~~vdLs~~L~e~v~V 80 (125)
|||||+.|.++.+| ++.+|+.++|||+||+.+++|+|+|++.+. + +|+|+..+||+++|+|+|||
T Consensus 26 IdvNsi~S~~s~~~------------~l~sG~~~~v~I~Yd~~~~~L~V~l~~~~~-~--~p~ls~~vdLs~~l~e~v~V 90 (133)
T 1qmo_E 26 IDVNSIRSKVTAKW------------DWQNGKIATAHISYNSVSKRLSVTSYYAGS-K--PATLSYDIELHTVLPEWVRV 90 (133)
T ss_dssp EEESSSSCSEEEEC------------CCCTTSCEEEEEEEETTTTEEEEEEECSSS-C--CEEEEEECCGGGTSCSEEEE
T ss_pred Eecccccccceeee------------EEcCCCEEEEEEEEeCCCcEEEEEEccCCC-c--cceEEEeechHHhccccEEE
Confidence 79999999999875 367999999999999999999999998754 2 79999999999999999999
Q ss_pred EEEeecCCceeeeEEEeEEEEeCC
Q 047244 81 GFSASTGLITASHNVHGWSISIGG 104 (125)
Q Consensus 81 GFSAsTG~~~e~h~i~sWsF~~~~ 104 (125)
||||+||...|.|+|++|+|++++
T Consensus 91 GFSAsTG~~~~~h~IlsWsF~s~l 114 (133)
T 1qmo_E 91 GLSASTGQDKERNTVHSWSFTSSL 114 (133)
T ss_dssp EEEEECSSSCCEEEEEEEEEEEEE
T ss_pred EEEeccCCCcceeEEEEEEEEeeC
Confidence 999999999999999999999876
|
| >1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* | Back alignment and structure |
|---|
| >3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... | Back alignment and structure |
|---|
| >3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* | Back alignment and structure |
|---|
| >3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... | Back alignment and structure |
|---|
| >1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* | Back alignment and structure |
|---|
| >2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* | Back alignment and structure |
|---|
| >2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} | Back alignment and structure |
|---|
| >1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* | Back alignment and structure |
|---|
| >1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* | Back alignment and structure |
|---|
| >1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* | Back alignment and structure |
|---|
| >1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* | Back alignment and structure |
|---|
| >1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* | Back alignment and structure |
|---|
| >1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* | Back alignment and structure |
|---|
| >1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* | Back alignment and structure |
|---|
| >1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* | Back alignment and structure |
|---|
| >1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... | Back alignment and structure |
|---|
| >2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} | Back alignment and structure |
|---|
| >1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* | Back alignment and structure |
|---|
| >2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B | Back alignment and structure |
|---|
| >1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A | Back alignment and structure |
|---|
| >2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* | Back alignment and structure |
|---|
| >2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 | Back alignment and structure |
|---|
| >2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* | Back alignment and structure |
|---|
| >2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A | Back alignment and structure |
|---|
| >2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 125 | ||||
| d1ukga_ | 241 | b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero | 1e-19 | |
| g1qmo.1 | 230 | b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich | 1e-18 | |
| d1hqla_ | 236 | b.29.1.1 (A:) Legume lectin {Griffonia simplicifol | 1e-18 | |
| d1nlsa_ | 237 | b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia | 2e-18 | |
| d1qnwa_ | 237 | b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus | 5e-18 | |
| d1f9ka_ | 234 | b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca | 2e-17 | |
| d1gzca_ | 239 | b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( | 2e-17 | |
| d2d3sa1 | 237 | b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso | 2e-17 | |
| g2ltn.1 | 229 | b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum | 4e-17 | |
| d1leda_ | 243 | b.29.1.1 (A:) Legume lectin {West-central african | 5e-17 | |
| d1avba_ | 226 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 7e-17 | |
| d1g7ya_ | 253 | b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos | 8e-17 | |
| d1g9fa_ | 251 | b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) | 1e-16 | |
| d1v6ia_ | 232 | b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog | 1e-16 | |
| d1ioaa_ | 228 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 1e-16 | |
| d1n47a_ | 233 | b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi | 2e-16 | |
| d1dbna_ | 239 | b.29.1.1 (A:) Legume lectin {Maackia amurensis, le | 6e-16 | |
| d1fx5a_ | 240 | b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus | 1e-15 | |
| d1g8wa_ | 233 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 2e-15 | |
| d1dhkb_ | 204 | b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar | 5e-15 | |
| d1fnya_ | 237 | b.29.1.1 (A:) Legume lectin {Black locust (Robinia | 7e-15 | |
| d1gv9a_ | 228 | b.29.1.13 (A:) Carbohydrate-recognition domain of | 2e-09 |
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Legume lectins domain: Legume lectin species: Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]
Score = 78.7 bits (193), Expect = 1e-19
Identities = 19/83 (22%), Positives = 36/83 (43%), Gaps = 3/83 (3%)
Query: 19 RNNHRIPILLRSGDPIRAWVDYSSQEMLIKVSKSPLGVPKPRRPLISFPIDLSLVLDEYM 78
R+ + R G + V ++ + V R +S+ +D+ VL E++
Sbjct: 155 RSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVV---ATYSDGTRYEVSYEVDVRSVLPEWV 211
Query: 79 YRGFSASTGLITASHNVHGWSIS 101
GFSA++G +H + WS +
Sbjct: 212 RVGFSAASGEQYQTHTLESWSFT 234
|
| >d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 | Back information, alignment and structure |
|---|
| >d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 | Back information, alignment and structure |
|---|
| >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 | Back information, alignment and structure |
|---|
| >d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 | Back information, alignment and structure |
|---|
| >d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 | Back information, alignment and structure |
|---|
| >d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 | Back information, alignment and structure |
|---|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 | Back information, alignment and structure |
|---|
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 | Back information, alignment and structure |
|---|
| >d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 | Back information, alignment and structure |
|---|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 125 | |||
| d1hqla_ | 236 | Legume lectin {Griffonia simplicifolia, lectin I-b | 99.93 | |
| d1qnwa_ | 237 | Legume lectin {Furze (Ulex europaeus), UEA-II [Tax | 99.92 | |
| d1gzca_ | 239 | Legume lectin {Cockspur coral tree (Erythrina cris | 99.92 | |
| d1leda_ | 243 | Legume lectin {West-central african legume (Griffo | 99.92 | |
| d1nlsa_ | 237 | Concanavalin A {Jack bean (Canavalia ensiformis) [ | 99.92 | |
| d1g9fa_ | 251 | Legume lectin {Soybean (Glycine max) [TaxId: 3847] | 99.92 | |
| d2d3sa1 | 237 | Legume lectin {Winged bean (Psophocarpus tetragono | 99.91 | |
| d1fx5a_ | 240 | Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI | 99.91 | |
| d1f9ka_ | 234 | Legume lectin {Winged bean (Psophocarpus tetragono | 99.91 | |
| d1ukga_ | 241 | Legume lectin {Bloodwood tree (Pterocarpus angolen | 99.91 | |
| d1g7ya_ | 253 | Legume lectin {Horse gram (Dolichos biflorus), dif | 99.9 | |
| d1n47a_ | 233 | Legume lectin {Hairy vetch (Vicia villosa), isolec | 99.9 | |
| d1ioaa_ | 228 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.89 | |
| g1qmo.1 | 230 | Legume lectin {Field bean (Dolichos lablab), Fril | 99.89 | |
| d1dhkb_ | 204 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.88 | |
| d1fnya_ | 237 | Legume lectin {Black locust (Robinia pseudoacacia) | 99.88 | |
| d1v6ia_ | 232 | Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 | 99.88 | |
| d1g8wa_ | 233 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.88 | |
| d1dbna_ | 239 | Legume lectin {Maackia amurensis, leukoagglutinin | 99.87 | |
| d1avba_ | 226 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.87 | |
| g2ltn.1 | 229 | Legume lectin {Garden pea (Pisum sativum) [TaxId: | 99.84 | |
| d1gv9a_ | 228 | Carbohydrate-recognition domain of P58/ERGIC-53 {R | 99.09 | |
| d2a6va1 | 218 | Emp46p N-terminal domain {Baker's yeast (Saccharom | 98.17 | |
| d2a6za1 | 221 | Emp47p N-terminal domain {Baker's yeast (Saccharom | 97.81 |
| >d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Legume lectins domain: Legume lectin species: Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]
Probab=99.93 E-value=1.2e-26 Score=177.10 Aligned_cols=92 Identities=23% Similarity=0.225 Sum_probs=82.6
Q ss_pred CccCCccccceeecCcccCCCCccceeecCCCcEEEEEEEcCCCCEEEEEEEeCCCCCCCCceeeeeecCCccCCCeeeE
Q 047244 1 ILISSLIPSASEPAYYYSRNNHRIPILLRSGDPIRAWVDYSSQEMLIKVSKSPLGVPKPRRPLISFPIDLSLVLDEYMYR 80 (125)
Q Consensus 1 IdiNsv~S~~t~~~~~~~~~~~~~~~~l~~G~~~~awI~Yd~~~~~L~V~l~~~~~~~p~~p~ls~~vdLs~~L~e~v~V 80 (125)
||||+++|.++.++. ..++.+|+.++|||+||+.+|+|+|+|++. +|..|+|++.|||+++|+|+|||
T Consensus 144 Idvns~~s~~~~~~~---------~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~---~~~~~~ls~~vdL~~~l~~~v~v 211 (236)
T d1hqla_ 144 INVNSIVSVATKRWE---------DSDIFSGKIATARISYDGSAEILTVVLSYP---DGSDYILSHSVDMRQNLPESVRV 211 (236)
T ss_dssp EEESSSSCSEEEECC---------HHHHTSCSCEEEEEEEETTTTEEEEEEEET---TTEEEEEEEECCGGGTSCSEEEE
T ss_pred EEcCCcccccccccc---------cccccCCCEEEEEEEEeCCCcEEEEEEecC---CCCCeeEEEEeCHHHhCCCcEEE
Confidence 689999999888764 457899999999999999999999999975 46678999999999999999999
Q ss_pred EEEeecCCc-eeeeEEEeEEEEeCC
Q 047244 81 GFSASTGLI-TASHNVHGWSISIGG 104 (125)
Q Consensus 81 GFSAsTG~~-~e~h~i~sWsF~~~~ 104 (125)
|||||||.. .+.|+|++|+|++++
T Consensus 212 GFSasTG~~~~~~h~I~sWsF~s~l 236 (236)
T d1hqla_ 212 GISASTGNNQFLTVYILSWRFSSNL 236 (236)
T ss_dssp EEEEECCSCCCEEEEEEEEEEEEEC
T ss_pred EEEeECCCCCceEEEEEEeEeEecC
Confidence 999999975 688999999999753
|
| >d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} | Back information, alignment and structure |
|---|
| >d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} | Back information, alignment and structure |
|---|
| >d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} | Back information, alignment and structure |
|---|
| >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} | Back information, alignment and structure |
|---|
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|