Citrus Sinensis ID: 047248

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44

MQFEAGISLSRGAAVTEGPSLSPSLNQDALWQMNLRTNEAMESGSLPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARIKGDYPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVSLRGSPVYPTVQSPTTPSQQSYAGGITNWSRASFIPSPRWQGPSSYAPMLLPQGMVSVPGWNTYSGQLGSVSSSENLQQTSGNSQIYGASRQTEPSNSGSQGTMSSFRSGSVPVGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSASSSADAPVRRFLGSSSATGALNLSSEGLVEAGSGRRLSLPETRQMSSGDDEIDTEG

ccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

******************************************************CSYYIRTGLCRFGATCRFNHPPNRKLAIATARIKGDYPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYLRTGQCKFGSTCKFHH*******************************GGITNWSRASFIPSPRW*****YAPMLLPQGMVSVPGWNTY*****************************************SFRSGSVPVGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGI***************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Zinc finger CCCH domain-containing protein 33		probable	Q8GXX7
Zinc finger CCCH domain-containing protein ZFN-like		probable	Q9SWF9
Zinc finger CCCH domain-containing protein 63		probable	Q2R4J4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 48-89
View the alignment between query and template
View the model in PyMOL

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 301-343
View the alignment between query and template
View the model in PyMOL

Template: 2CQE, chain A
Confidence level:very confident
Coverage over the Query: 45-75,97-132
View the alignment between query and template
View the model in PyMOL

Template: 3U9G, chain A
Confidence level:probable
Coverage over the Query: 54-120,146-169
View the alignment between query and template
View the model in PyMOL