Citrus Sinensis ID: 047269

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MKAENEYKKGLWTQEEDRILLEYIRVHGRGQWNRIHKVTGLKRCGKSCRLRWLNYLSPNVKHGEFTEEEENLIIRLHNLLGNRWSLIAGRVPGRTDNQVKNHWNTHLCKKLGINKKQKKKFVSSSKTQAQTQSSRIIKDDNGLTHDNLNFEHLQDSEMALDQEPGDRKKSNEEAESINHHCNESLLLPTEDDFLNLCSPILLEFLEGQPLDLIWHNN
cccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHcccccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccc
*********GLWTQEEDRILLEYIRVHGRGQWNRIHKVTGLKRCGKSCRLRWLNYLSPNVKHGEFTEEEENLIIRLHNLLGNRWSLIAGRVPGRTDNQVKNHWNTHLCKKLGI*********************************************************************ESLLLPTEDDFLNLCSPILLEFLEGQPLDLIWHN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAENEYKKGLWTQEEDRILLEYIRVHGRGQWNRIHKVTGLKRCGKSCRLRWLNYLSPNVKHGEFTEEEENLIIRLHNLLGNRWSLIAGRVPGRTDNQVKNHWNTHLCKKLGINKKQKKKFVSSSKTQAQTQSSRIIKDDNGLTHDNLNFEHLQDSEMALDQEPGDRKKSNEEAESINHHCNESLLLPTEDDFLNLCSPILLEFLEGQPLDLIWHNN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor WER Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC.probableQ9SEI0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H89, chain C
Confidence level:very confident
Coverage over the Query: 4-109
View the alignment between query and template
View the model in PyMOL