Citrus Sinensis ID: 047282


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNSSLEMDDETTNPVSNPKRRRKNITALVVRLSLGGGKLGQGGFGGVDKGFLRETNSFFSNWNVQLKHGKAVALCKGLFRDIRNPTGPYGGEATGSNPGISKSTRFKN
cEEEEEEcccccEEEEEEEEEccccEEEEEEEEcccccccccEEEEEEcccccccccEEEEEEEcccccEEEEEEEEEEEccccccccccccccccccccccEEEEEEEEEEccccEEccccEEEEEEEEEEEccEEEEEcEEEEEccccccccccEEEEEccccccccccEEEcccccEEEEEEEc
cEEEEEEcccccEEEEEEEEEccccEEEEEEEccccccccccEEEEEccHHHHcccEEEEEEEEEEcccEEEEEEEEEEEEccccccccccccccccccccccEEEEEEEcccccEEEcccccHHHHHcHHHccHHHHccccEEEEccEEEEEccccEEcccccccccccccccccccccEEEEEcc
myllrsdvksgrrnEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHlpefvtfgfsmetgvdFTIFSIYLWEfnsslemddettnpvsnpkrrrKNITALVVRLSlgggklgqggfggvdkgflRETNSFFSNWNVQLKHGKAVALCKGLfrdirnptgpyggeatgsnpgiskstrfkn
myllrsdvksgrrneAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNsslemddettnpvsnpkrrrknITALVVRlslgggklgqggfGGVDKGFLRETNSFFSNWNVQLKHGKAVALCKGLFRDIrnptgpyggeatgsnpgiskstrfkn
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNSSLEMDDETTNPVSNPKRRRKNITALVVRlslgggklgqggfggvdkgflRETNSFFSNWNVQLKHGKAVALCKGLFRDIRNPTGPYGGEATGSNPGISKSTRFKN
***************AWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNS********************NITALVVRLSLGGGKLGQGGFGGVDKGFLRETNSFFSNWNVQLKHGKAVALCKGLFRDIR*************************
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNSSL***********************VVRLSLGGGKLGQGGFGGVDKGFLRETNSF***********************************TGSNPGIS*S*RFK*
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNSSLEM************RRRKNITALVVRLSLGGGKLGQGGFGGVDKGFLRETNSFFSNWNVQLKHGKAVALCKGLFRDIRNPTGPYGGEATGSNPGISKSTRFKN
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNSSLEMD*************RKNITALVVRLSLGGGKLGQGGFGGVDKGFLRETNSFFSNWNVQLKHGKAVALCKGLFRDIRNPTGPYGGEATGSNPGISKSTRFKN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLLRSDVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNSSLEMDDETTNPVSNPKRRRKNITALVVRLSLGGGKLGQGGFGGVDKGFLRETNSFFSNWNVQLKHGKAVALCKGLFRDIRNPTGPYGGEATGSNPGISKSTRFKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query187 2.2.26 [Sep-21-2011]
Q39528293 Agglutinin-1 OS=Cladrasti N/A no 0.390 0.249 0.394 2e-05
Q39529290 Agglutinin-2 OS=Cladrasti N/A no 0.411 0.265 0.389 0.0001
Q93WH6275 Lectin OS=Lens culinaris N/A no 0.417 0.283 0.308 0.0001
P02870275 Lectin OS=Lens culinaris N/A no 0.417 0.283 0.308 0.0001
Q8VXF2275 Lectin OS=Lens culinaris N/A no 0.417 0.283 0.308 0.0001
Q93X49275 Lectin OS=Lens culinaris N/A no 0.417 0.283 0.308 0.0001
P81637237 Lectin alpha chain OS=Dio N/A no 0.406 0.320 0.373 0.0003
P58907237 Lectin alpha chain OS=Dio N/A no 0.406 0.320 0.373 0.0003
Q9LXA5 651 L-type lectin-domain cont no no 0.481 0.138 0.313 0.0006
P16349244 Lectin OS=Lathyrus sphaer N/A no 0.358 0.274 0.362 0.0007
>sp|Q39528|LEC1_CLAKE Agglutinin-1 OS=Cladrastis kentukea PE=1 SV=1 Back     alignment and function desciption
 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 9   KSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGV 68
           ++G +  A ISYN ++  L+ A T + N++ +   LD  +DL+  LPE+V  GFS  TG 
Sbjct: 205 QNGVKATAQISYNPASQKLT-AVTSYPNSTPLTVSLD--IDLQTVLPEWVRVGFSASTGQ 261

Query: 69  DFTIFSIYLWEFNSSL 84
           +    SI  W F+SSL
Sbjct: 262 NVERNSILAWSFSSSL 277




Bark lectins are storage proteins that probably maintain stocks of nitrogen during dormant period. Self-aggregatable molecules that can bind their own carbohydrate side chains. They could also play a role in the plant's defense against phytophagous invertebrates or herbivorous higher animals.
Cladrastis kentukea (taxid: 38412)
>sp|Q39529|LEC2_CLAKE Agglutinin-2 OS=Cladrastis kentukea PE=1 SV=1 Back     alignment and function description
>sp|Q93WH6|LEC_LENCC Lectin OS=Lens culinaris subsp. culinaris PE=3 SV=2 Back     alignment and function description
>sp|P02870|LEC_LENCU Lectin OS=Lens culinaris PE=1 SV=2 Back     alignment and function description
>sp|Q8VXF2|LEC_LENCT Lectin OS=Lens culinaris subsp. tomentosus PE=3 SV=2 Back     alignment and function description
>sp|Q93X49|LEC_LENCO Lectin OS=Lens culinaris subsp. orientalis PE=3 SV=2 Back     alignment and function description
>sp|P81637|LECA_DIOGU Lectin alpha chain OS=Dioclea guianensis PE=1 SV=1 Back     alignment and function description
>sp|P58907|LECA_DIOVI Lectin alpha chain OS=Dioclea virgata PE=1 SV=2 Back     alignment and function description
>sp|Q9LXA5|LRK91_ARATH L-type lectin-domain containing receptor kinase IX.1 OS=Arabidopsis thaliana GN=LECRK91 PE=2 SV=1 Back     alignment and function description
>sp|P16349|LEC_LATSP Lectin OS=Lathyrus sphaericus PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
224092745 681 predicted protein [Populus trichocarpa] 0.711 0.195 0.407 6e-24
224096774 713 predicted protein [Populus trichocarpa] 0.491 0.129 0.589 2e-23
225470605 720 PREDICTED: L-type lectin-domain containi 0.652 0.169 0.492 3e-23
356527993 709 PREDICTED: L-type lectin-domain containi 0.679 0.179 0.446 5e-23
356527997 709 PREDICTED: L-type lectin-domain containi 0.700 0.184 0.423 1e-21
224059892 613 predicted protein [Populus trichocarpa] 0.475 0.145 0.561 2e-21
449479047 697 PREDICTED: L-type lectin-domain containi 0.727 0.195 0.356 3e-21
296088135 546 unnamed protein product [Vitis vinifera] 0.534 0.183 0.532 1e-20
449479044 678 PREDICTED: L-type lectin-domain containi 0.486 0.134 0.510 3e-20
449438590 665 PREDICTED: LOW QUALITY PROTEIN: L-type l 0.486 0.136 0.510 3e-20
>gi|224092745|ref|XP_002334872.1| predicted protein [Populus trichocarpa] gi|222831889|gb|EEE70366.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 75/184 (40%), Positives = 91/184 (49%), Gaps = 51/184 (27%)

Query: 6   SDVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSME 65
            D++ GRR EAWISYNSSTHNLSVAFTG+RNN+V MQ L   V LR +LPE V+FGFS  
Sbjct: 182 CDIRRGRRTEAWISYNSSTHNLSVAFTGYRNNTVEMQFLSQIVSLRDYLPERVSFGFSAS 241

Query: 66  TGVDFTIFSIYLWEFNSSLE---------------------------------------- 85
           TG  F I ++Y W+F+SSLE                                        
Sbjct: 242 TGDLFAIHTLYSWDFSSSLEIDDNNRTGLAVGLGVGGGAIVVGAALVGFVIKFMCGHEED 301

Query: 86  ----------MDDETTNPVSNPKRRRKNITALVVRLSLGGGKLGQGGFGGVDKGFLRETN 135
                     MDDE     + PK+      A          KLG+GGFGGV KGFL+E +
Sbjct: 302 EEGGHVLEEYMDDEFERG-TGPKKFSYQELARATSNFKDEEKLGEGGFGGVYKGFLKEID 360

Query: 136 SFFS 139
           SF +
Sbjct: 361 SFVA 364




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224096774|ref|XP_002334671.1| predicted protein [Populus trichocarpa] gi|222874064|gb|EEF11195.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225470605|ref|XP_002262748.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356527993|ref|XP_003532590.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information
>gi|356527997|ref|XP_003532592.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information
>gi|224059892|ref|XP_002300009.1| predicted protein [Populus trichocarpa] gi|222847267|gb|EEE84814.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449479047|ref|XP_004155490.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296088135|emb|CBI35556.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449479044|ref|XP_004155489.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449438590|ref|XP_004137071.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
UNIPROTKB|P02870275 P02870 "Lectin" [Lens culinari 0.417 0.283 0.308 1.7e-05
UNIPROTKB|P58907237 P58907 "Lectin alpha chain" [D 0.406 0.320 0.373 6.8e-05
UNIPROTKB|P81637237 P81637 "Lectin alpha chain" [D 0.406 0.320 0.373 6.8e-05
TAIR|locus:2143528 711 AT5G03140 [Arabidopsis thalian 0.475 0.125 0.311 0.00023
TAIR|locus:2095390174 AT3G28230 "AT3G28230" [Arabido 0.224 0.241 0.523 0.00024
UNIPROTKB|P83721234 P83721 "Mannose/glucose-specif 0.401 0.320 0.384 0.00026
UNIPROTKB|P81517236 P81517 "Lectin alpha chain" [C 0.417 0.330 0.370 0.00026
UNIPROTKB|P58908237 P58908 "Lectin alpha chain" [D 0.406 0.320 0.361 0.00026
TAIR|locus:2142499 651 AT5G10530 [Arabidopsis thalian 0.379 0.109 0.388 0.00056
UNIPROTKB|B3EWJ2237 B3EWJ2 "Lectin alpha chain" [D 0.406 0.320 0.349 0.00091
UNIPROTKB|P02870 P02870 "Lectin" [Lens culinaris (taxid:3864)] Back     alignment and assigned GO terms
 Score = 115 (45.5 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 25/81 (30%), Positives = 44/81 (54%)

Query:     7 DVKSGRRNEAWISYNSSTHNLSVAFT---GFRNNSVVMQGLDYQVDLRQHLPEFVTFGFS 63
             ++++G R    I++N++T+ L+V  T        +V    L+  V L+  +PE+V  GFS
Sbjct:   183 NLQNGERANVVIAFNAATNVLTVTLTYPNSLEEENVTSYTLNEVVPLKDVVPEWVRIGFS 242

Query:    64 METGVDFTIFSIYLWEFNSSL 84
               TG +F    ++ W F+S L
Sbjct:   243 ATTGAEFAAHEVHSWSFHSEL 263




GO:0005509 "calcium ion binding" evidence=IDA
GO:0009756 "carbohydrate mediated signaling" evidence=TAS
GO:0030145 "manganese ion binding" evidence=IDA
GO:0030246 "carbohydrate binding" evidence=IDA
UNIPROTKB|P58907 P58907 "Lectin alpha chain" [Dioclea virgata (taxid:167618)] Back     alignment and assigned GO terms
UNIPROTKB|P81637 P81637 "Lectin alpha chain" [Dioclea guianensis (taxid:99571)] Back     alignment and assigned GO terms
TAIR|locus:2143528 AT5G03140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095390 AT3G28230 "AT3G28230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P83721 P83721 "Mannose/glucose-specific lectin Cramoll" [Cratylia mollis (taxid:252530)] Back     alignment and assigned GO terms
UNIPROTKB|P81517 P81517 "Lectin alpha chain" [Cratylia argentea (taxid:83131)] Back     alignment and assigned GO terms
UNIPROTKB|P58908 P58908 "Lectin alpha chain" [Dioclea rostrata (taxid:192416)] Back     alignment and assigned GO terms
TAIR|locus:2142499 AT5G10530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B3EWJ2 B3EWJ2 "Lectin alpha chain" [Dioclea sclerocarpa (taxid:1176036)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.17120001
hypothetical protein (713 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
cd06899236 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume 9e-16
pfam00139231 pfam00139, Lectin_legB, Legume lectin domain 9e-08
pfam0936876 pfam09368, Sas10_Utp3_C, Sas10 C-terminal domain 6e-05
cd01951223 cd01951, lectin_L-type, legume lectins 3e-04
>gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
 Score = 71.9 bits (177), Expect = 9e-16
 Identities = 30/76 (39%), Positives = 39/76 (51%)

Query: 9   KSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGV 68
           KSG+  +AWI Y+SS+  LSV              L Y VDL + LPE V  GFS  TG+
Sbjct: 161 KSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGL 220

Query: 69  DFTIFSIYLWEFNSSL 84
              +  I  W F+S+ 
Sbjct: 221 LTELHYILSWSFSSNG 236


This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236

>gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain Back     alignment and domain information
>gnl|CDD|220207 pfam09368, Sas10_Utp3_C, Sas10 C-terminal domain Back     alignment and domain information
>gnl|CDD|173886 cd01951, lectin_L-type, legume lectins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 187
cd06899236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 99.8
PF00139236 Lectin_legB: Legume lectin domain; InterPro: IPR00 99.77
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 99.56
cd07308218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 98.17
KOG1187 361 consensus Serine/threonine protein kinase [Signal 97.9
KOG0595 429 consensus Serine/threonine-protein kinase involved 97.77
cd06902225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 97.68
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 97.67
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 97.56
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 97.53
PF0936876 Sas10: Sas10 C-terminal domain; InterPro: IPR01897 97.46
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 97.43
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 97.38
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 97.22
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 97.12
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 97.05
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 96.9
PTZ00036 440 glycogen synthase kinase; Provisional 96.89
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 96.78
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 96.75
KOG0575 592 consensus Polo-like serine/threonine protein kinas 96.72
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 96.71
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 96.7
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 96.69
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 96.68
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 96.67
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 96.67
PTZ00284 467 protein kinase; Provisional 96.67
KOG0192 362 consensus Tyrosine kinase specific for activated ( 96.65
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 96.65
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 96.61
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 96.59
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 96.59
PTZ00263 329 protein kinase A catalytic subunit; Provisional 96.57
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 96.55
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 96.54
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 96.54
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 96.52
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 96.51
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 96.51
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 96.5
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 96.5
PF03388229 Lectin_leg-like: Legume-like lectin family; InterP 96.49
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 96.48
PRK09188 365 serine/threonine protein kinase; Provisional 96.48
KOG2052 513 consensus Activin A type IB receptor, serine/threo 96.47
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 96.47
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 96.46
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 96.44
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 96.44
KOG0661 538 consensus MAPK related serine/threonine protein ki 96.44
KOG0598 357 consensus Ribosomal protein S6 kinase and related 96.42
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 96.39
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 96.38
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 96.38
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 96.38
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 96.35
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 96.35
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 96.33
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 96.32
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 96.32
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 96.31
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 96.31
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 96.31
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 96.31
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 96.3
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 96.29
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 96.28
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 96.28
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 96.27
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 96.27
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 96.27
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 96.25
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 96.25
KOG0580 281 consensus Serine/threonine protein kinase [Cell cy 96.25
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 96.23
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 96.22
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 96.22
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 96.21
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 96.2
PLN00034 353 mitogen-activated protein kinase kinase; Provision 96.19
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 96.19
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 96.18
PHA03212 391 serine/threonine kinase US3; Provisional 96.18
PTZ00283 496 serine/threonine protein kinase; Provisional 96.18
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 96.17
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 96.16
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 96.16
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 96.16
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 96.15
cd06903215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 96.14
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 96.14
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 96.12
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 96.11
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 96.11
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 96.11
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 96.1
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 96.1
KOG3653 534 consensus Transforming growth factor beta/activin 96.09
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 96.09
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 96.09
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 96.09
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 96.09
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 96.07
PLN03224 507 probable serine/threonine protein kinase; Provisio 96.05
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 96.05
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 96.04
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 96.04
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 96.03
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 96.03
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 96.03
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 96.02
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 96.02
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 96.02
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 96.02
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 96.01
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 96.01
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 96.0
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 96.0
cd05147 190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 96.0
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 95.99
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 95.99
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 95.98
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 95.98
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 95.97
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 95.97
PTZ00024 335 cyclin-dependent protein kinase; Provisional 95.96
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 95.96
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 95.96
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 95.96
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 95.96
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 95.93
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 95.93
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 95.93
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 95.92
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 95.91
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 95.9
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 95.89
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 95.89
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 95.89
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 95.88
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 95.88
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 95.87
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 95.87
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 95.85
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 95.85
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 95.85
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 95.85
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 95.84
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 95.83
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 95.82
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 95.82
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 95.82
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 95.82
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 95.82
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 95.82
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 95.81
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 95.8
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 95.79
cd06901248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 95.78
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 95.78
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 95.78
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 95.78
KOG0605 550 consensus NDR and related serine/threonine kinases 95.76
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 95.76
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 95.76
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 95.75
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 95.75
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 95.75
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 95.74
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 95.74
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 95.74
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 95.73
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 95.73
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 95.73
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 95.73
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 95.73
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 95.71
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 95.69
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 95.69
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 95.68
KOG0198 313 consensus MEKK and related serine/threonine protei 95.68
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 95.67
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 95.67
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 95.67
KOG3838 497 consensus Mannose lectin ERGIC-53, involved in gly 95.66
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 95.66
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 95.66
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 95.65
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 95.65
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 95.65
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 95.64
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 95.63
KOG0201 467 consensus Serine/threonine protein kinase [Signal 95.63
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 95.62
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 95.62
PHA03209 357 serine/threonine kinase US3; Provisional 95.62
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 95.61
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 95.59
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 95.58
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 95.58
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 95.57
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 95.57
PLN00009 294 cyclin-dependent kinase A; Provisional 95.56
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 95.56
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 95.56
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 95.54
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 95.54
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 95.54
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 95.53
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 95.53
cd05145 190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 95.52
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 95.51
KOG0577 948 consensus Serine/threonine protein kinase [Signal 95.51
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 95.49
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 95.49
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 95.48
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 95.47
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 95.46
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 95.46
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 95.46
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 95.45
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 95.45
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 95.44
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 95.43
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 95.41
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 95.41
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 95.4
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 95.4
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 95.4
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 95.4
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 95.39
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 95.38
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 95.38
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 95.37
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 95.36
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 95.36
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 95.36
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 95.36
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 95.33
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 95.33
PHA03211 461 serine/threonine kinase US3; Provisional 95.33
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 95.32
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 95.31
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 95.28
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 95.28
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 95.28
smart00221 225 STYKc Protein kinase; unclassified specificity. Ph 95.27
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 95.26
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 95.26
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 95.26
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 95.25
KOG0581 364 consensus Mitogen-activated protein kinase kinase 95.24
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 95.23
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 95.22
PHA02988 283 hypothetical protein; Provisional 95.22
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 95.21
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 95.21
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 95.19
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 95.19
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 95.19
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 95.18
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 95.17
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 95.17
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 95.15
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 95.14
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 95.13
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 95.13
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 95.12
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 95.12
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 95.12
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 95.11
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 95.1
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 95.1
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 95.09
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 95.08
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 95.06
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 95.05
KOG0583 370 consensus Serine/threonine protein kinase [Signal 95.02
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 95.02
cd05119 187 RIO RIO kinase family, catalytic domain. The RIO k 95.02
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 94.99
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 94.99
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 94.99
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 94.98
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 94.97
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 94.96
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 94.96
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 94.94
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 94.94
KOG0694 694 consensus Serine/threonine protein kinase [Signal 94.94
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 94.92
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 94.9
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 94.9
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 94.88
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 94.87
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 94.87
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 94.86
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 94.82
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 94.78
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 94.77
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 94.75
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 94.75
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 94.75
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 94.73
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 94.73
PTZ00267 478 NIMA-related protein kinase; Provisional 94.73
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 94.73
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 94.72
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 94.69
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 94.69
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 94.66
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 94.63
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 94.63
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 94.62
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 94.55
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 94.52
cd00180 215 PKc Catalytic domain of Protein Kinases. Protein K 94.5
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 94.45
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 94.44
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 94.43
PHA02882 294 putative serine/threonine kinase; Provisional 94.42
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 94.35
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 94.31
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 94.3
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 94.28
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 94.28
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 94.22
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 94.16
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 94.15
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 94.14
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 94.13
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 94.11
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 94.06
KOG1989 738 consensus ARK protein kinase family [Signal transd 93.99
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 93.96
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 93.95
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 93.91
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 93.83
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 93.81
PHA03207 392 serine/threonine kinase US3; Provisional 93.75
PTZ00266 1021 NIMA-related protein kinase; Provisional 93.75
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 93.72
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 93.57
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 93.45
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 93.45
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 93.44
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 93.42
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 93.41
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 93.28
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 93.24
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 93.23
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 93.05
KOG0578 550 consensus p21-activated serine/threonine protein k 93.03
KOG0582 516 consensus Ste20-like serine/threonine protein kina 92.97
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 92.95
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 92.9
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 92.88
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 92.8
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 92.75
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 92.72
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 92.59
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 92.57
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 92.44
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 92.22
cd05144 198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 92.15
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 92.09
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 91.91
KOG3118517 consensus Disrupter of silencing SAS10 [Chromatin 91.73
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 91.69
smart00090 237 RIO RIO-like kinase. 91.66
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 91.6
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 91.52
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 91.47
KOG0610 459 consensus Putative serine/threonine protein kinase 91.46
KOG0586 596 consensus Serine/threonine protein kinase [General 91.46
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 91.41
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 91.31
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 91.3
PRK10345 210 hypothetical protein; Provisional 91.3
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 91.24
PRK14879 211 serine/threonine protein kinase; Provisional 90.72
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 90.64
cd06900255 lectin_VcfQ VcfQ bacterial pilus biogenesis protei 90.58
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 90.46
TIGR03724 199 arch_bud32 Kae1-associated kinase Bud32. Members o 90.18
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 89.78
PHA03210 501 serine/threonine kinase US3; Provisional 89.73
KOG4721 904 consensus Serine/threonine protein kinase, contain 89.12
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 89.04
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 88.85
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 88.82
KOG0589 426 consensus Serine/threonine protein kinase [General 88.45
KOG0611 668 consensus Predicted serine/threonine protein kinas 87.68
KOG3839351 consensus Lectin VIP36, involved in the transport 87.48
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 87.36
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 86.83
KOG0671 415 consensus LAMMER dual specificity kinases [Signal 85.56
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 85.12
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 83.66
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 83.61
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 82.45
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 82.28
PRK09605 535 bifunctional UGMP family protein/serine/threonine 80.87
PF14531 288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 80.35
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
Probab=99.80  E-value=1.6e-19  Score=150.39  Aligned_cols=77  Identities=39%  Similarity=0.568  Sum_probs=72.7

Q ss_pred             ccCCCceEEEEEEeeCCCceEEEEEEeCCCCCcccceeEEEecCCccCCceeEEEEEeecCCCccccceeeeeeccC
Q 047282            7 DVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNSS   83 (187)
Q Consensus         7 ~l~~G~~~~awI~Yd~~~~~L~V~ls~~~~~~p~~p~ls~~vdLs~~L~~~v~VGFSasTG~~~~~h~i~sW~F~~~   83 (187)
                      +|.+|+.++|||+||+.+++|+|+|.+.+..+|..|+|+..+||+++|+++|||||||+||...+.|+|++|+|++.
T Consensus       159 ~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s~  235 (236)
T cd06899         159 KLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSN  235 (236)
T ss_pred             cccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEcC
Confidence            36799999999999999999999999887668999999999999999999999999999999999999999999875



This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin

>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF09368 Sas10: Sas10 C-terminal domain; InterPro: IPR018972 This entry represents the C-terminal domain of the Something about silencing protein 10 (Sas10), which is essential for gene silencing and has a role in the structure of silenced chromatin [, ] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG3118 consensus Disrupter of silencing SAS10 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
1mvq_A236 Cratylia Mollis Lectin (Isoform 1) In Complex With 2e-05
3rrd_A237 Native Structure Of Dioclea Virgata Lectin Length = 3e-05
1h9w_A237 Native Dioclea Guianensis Seed Lectin Length = 237 3e-05
1h9p_A237 Crystal Structure Of Dioclea Guianensis Seed Lectin 3e-05
3u4x_A236 Crystal Structure Of A Lectin From Camptosema Pedic 3e-05
1hql_A257 The Xenograft Antigen In Complex With The B4 Isolec 5e-05
1gnz_A257 Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)m 6e-05
2jdz_A239 Crystal Structure Of Recombinant Dioclea Guianensis 6e-05
2je7_A239 Crystal Structure Of Recombinant Dioclea Guianensis 6e-05
1n3o_A252 Pterocarcpus Angolensis Lectin In Complex With Alph 7e-05
1q8o_A252 Pterocartpus Angolensis Lectin Pal In Complex With 7e-05
1qmo_E133 Structure Of Fril, A Legume Lectin That Delays Hema 7e-05
2bqp_A234 The Structure Of The Pea Lectin-D-Glucopyranose Com 8e-05
2d3p_A236 Cratylia Floribunda Seed Lectin Crystallized At Bas 9e-05
2zbj_A237 Crystal Structure Of Dioclea Rostrata Lectin Length 9e-05
1bjq_A253 The Dolichos Biflorus Seed Lectin In Complex With A 1e-04
3a0k_A237 Crystal Structure Of An Antiflamatory Legume Lectin 2e-04
1lul_A253 Db58, A Legume Lectin From Dolichos Biflorus Length 2e-04
2jec_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 2e-04
1dgl_A237 Lectin From Dioclea Grandiflora Complexed To Triman 3e-04
2je9_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 3e-04
3sh3_A237 Crystal Structure Of A Pro-Inflammatory Lectin From 3e-04
2gdf_A237 Crystal Structure Of Dioclea Violacea Seed Lectin L 3e-04
2fmd_A240 Structural Basis Of Carbohydrate Recognition By Bow 3e-04
>pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 32/83 (38%), Positives = 43/83 (51%), Gaps = 7/83 (8%) Query: 5 RSDVKSGRRNEAWISYNSSTHNLS--VAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGF 62 R DV++G+ A ISYNS LS V++ G + +V Y VDL LPE+V G Sbjct: 39 RWDVQNGKVGTAHISYNSVAKRLSAVVSYPGGSSATV-----SYDVDLNNILPEWVRVGL 93 Query: 63 SMETGVDFTIFSIYLWEFNSSLE 85 S TG+ +I W F S L+ Sbjct: 94 SASTGLYKETNTILSWSFTSKLK 116
>pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 Back     alignment and structure
>pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 Back     alignment and structure
>pdb|1HQL|A Chain A, The Xenograft Antigen In Complex With The B4 Isolectin Of Griffonia Simplicifolia Lectin-1 Length = 257 Back     alignment and structure
>pdb|1GNZ|A Chain A, Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)metal Free Form Length = 257 Back     alignment and structure
>pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 Back     alignment and structure
>pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 Back     alignment and structure
>pdb|1QMO|E Chain E, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 133 Back     alignment and structure
>pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 Back     alignment and structure
>pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 Back     alignment and structure
>pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 Back     alignment and structure
>pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 Back     alignment and structure
>pdb|3A0K|A Chain A, Crystal Structure Of An Antiflamatory Legume Lectin From Cymbosema Roseum Seeds Length = 237 Back     alignment and structure
>pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 Back     alignment and structure
>pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 Back     alignment and structure
>pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 Back     alignment and structure
>pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 Back     alignment and structure
>pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 2e-13
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 8e-12
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 1e-11
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 1e-11
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 2e-11
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 1e-10
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 2e-10
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 2e-10
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 5e-10
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 5e-10
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 6e-10
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 7e-10
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 7e-10
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 9e-10
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 1e-09
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 1e-09
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 2e-09
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 2e-09
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 2e-09
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 3e-09
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 7e-09
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 9e-09
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 1e-08
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 2e-08
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 3e-08
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 Back     alignment and structure
 Score = 63.2 bits (153), Expect = 2e-13
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 9/101 (8%)

Query: 9   KSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGV 68
           ++G+   A ISYNS +  LSV      +       L Y ++L   LPE+V  G S  TG 
Sbjct: 42  QNGKIATAHISYNSVSKRLSVTSYYAGSKPAT---LSYDIELHTVLPEWVRVGLSASTGQ 98

Query: 69  DFTIFSIYLWEFNSSLEMDDETTNPVSNPKRRRKNITALVV 109
           D    +++ W F SSL         V+  +   K IT  V+
Sbjct: 99  DKERNTVHSWSFTSSLW------TNVAKKENENKYITRGVL 133


>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 99.89
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 99.85
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 99.85
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 99.85
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 99.85
3ujo_A281 Legume lectin; carbohydrate-binding, galactose, ad 99.84
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 99.84
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 99.84
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 99.84
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 99.84
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 99.83
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 99.83
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 99.83
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 99.83
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 99.83
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 99.83
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 99.82
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 99.82
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 99.82
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 99.82
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 99.82
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 99.82
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 99.81
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 99.8
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 99.8
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 99.63
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.46
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 99.45
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 98.97
4aoj_A 329 High affinity nerve growth factor receptor; transf 98.02
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 97.99
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 97.97
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 97.96
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 97.91
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 97.87
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 97.85
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 97.81
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 97.79
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 97.79
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 97.77
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 97.76
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 97.73
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 97.7
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 97.48
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 97.48
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 97.43
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 97.37
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 97.37
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 97.32
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 97.3
3q4u_A 301 Activin receptor type-1; structural genomics conso 97.26
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 97.24
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 97.24
3o0g_A 292 Cell division protein kinase 5; kinase activator c 97.24
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 97.23
3uqc_A 286 Probable conserved transmembrane protein; structur 97.22
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 97.21
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 97.19
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 97.19
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 97.18
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 97.17
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 97.16
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 97.15
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 97.13
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 97.12
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 97.11
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 97.11
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 97.11
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 97.1
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 97.08
2a19_B 284 Interferon-induced, double-stranded RNA-activated 97.08
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 97.07
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 97.07
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 97.06
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 97.06
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 97.06
3bhy_A 283 Death-associated protein kinase 3; death associate 97.05
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 97.05
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 97.05
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 97.03
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 97.03
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 97.02
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 97.02
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 97.02
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 97.01
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 97.01
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 97.0
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 96.99
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 96.99
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 96.99
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 96.98
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 96.98
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 96.98
3niz_A 311 Rhodanese family protein; structural genomics, str 96.98
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 96.96
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 96.96
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 96.96
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 96.96
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 96.95
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 96.95
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 96.95
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 96.95
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 96.95
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 96.95
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 96.95
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 96.94
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 96.94
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 96.93
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 96.93
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 96.93
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 96.92
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 96.92
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 96.92
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 96.91
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 96.91
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 96.91
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 96.9
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 96.9
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 96.9
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 96.9
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 96.9
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 96.9
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 96.89
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 96.89
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 96.89
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 96.89
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 96.88
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 96.88
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 96.87
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 96.87
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 96.87
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 96.87
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 96.86
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 96.85
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 96.84
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 96.84
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 96.84
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 96.83
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 96.83
3fme_A 290 Dual specificity mitogen-activated protein kinase; 96.83
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 96.83
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 96.83
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 96.82
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 96.82
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 96.82
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 96.82
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 96.82
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 96.82
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 96.81
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 96.81
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 96.81
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 96.8
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 96.8
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 96.8
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 96.78
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 96.78
3ork_A 311 Serine/threonine protein kinase; structural genomi 96.78
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 96.77
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 96.77
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 96.77
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 96.76
3rp9_A 458 Mitogen-activated protein kinase; structural genom 96.76
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 96.76
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 96.75
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 96.75
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 96.74
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 96.74
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 96.74
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 96.73
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 96.73
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 96.72
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 96.72
3soc_A 322 Activin receptor type-2A; structural genomics cons 96.72
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 96.72
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 96.72
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 96.71
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 96.71
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 96.71
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 96.71
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 96.7
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 96.7
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 96.68
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 96.68
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 96.67
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 96.67
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 96.67
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 96.67
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 96.66
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 96.65
3an0_A 340 Dual specificity mitogen-activated protein kinase; 96.65
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 96.64
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 96.64
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 96.6
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 96.6
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 96.6
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 96.6
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 96.58
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 96.58
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 96.57
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 96.57
3pls_A 298 Macrophage-stimulating protein receptor; protein k 96.57
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 96.56
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 96.56
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 96.54
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 96.54
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 96.54
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 96.54
3aln_A 327 Dual specificity mitogen-activated protein kinase; 96.53
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 96.53
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 96.52
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 96.52
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 96.51
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 96.51
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 96.5
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 96.5
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 96.5
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 96.5
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 96.5
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 96.49
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 96.48
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 96.48
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 96.48
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 96.45
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 96.45
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 96.45
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 96.44
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 96.44
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 96.44
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 96.43
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 96.43
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 96.42
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 96.42
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 96.42
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 96.4
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 96.39
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 96.38
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 96.38
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 96.37
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 96.32
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 96.3
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 96.29
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 96.29
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 96.28
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 96.28
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 96.28
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 96.26
2dyl_A 318 Dual specificity mitogen-activated protein kinase 96.26
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 96.26
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 96.25
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 96.23
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 96.22
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 96.19
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 96.17
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 96.16
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 96.16
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 96.15
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 96.12
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 96.1
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 96.07
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 96.05
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 96.04
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 96.01
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 96.01
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 96.0
1zth_A 258 RIO1 serine protein kinase; ribosome biogenesis, r 96.0
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 95.98
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 95.89
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 95.82
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 95.81
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 95.79
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 95.76
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 95.74
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 95.59
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 95.56
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 95.54
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 95.5
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 95.44
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 95.28
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 95.2
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 95.07
1zar_A 282 RIO2 kinase; serine kinase, winged-helix, RIO doma 94.9
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 94.33
3en9_A 540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 93.61
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 92.52
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 91.76
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
Probab=99.89  E-value=1.9e-23  Score=159.02  Aligned_cols=77  Identities=36%  Similarity=0.488  Sum_probs=71.3

Q ss_pred             ccCCCceEEEEEEeeCCCceEEEEEEeCCCCCcccceeEEEecCCccCCceeEEEEEeecCCCccccceeeeeeccCCCC
Q 047282            7 DVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNSSLEM   86 (187)
Q Consensus         7 ~l~~G~~~~awI~Yd~~~~~L~V~ls~~~~~~p~~p~ls~~vdLs~~L~~~v~VGFSasTG~~~~~h~i~sW~F~~~~~~   86 (187)
                      +|.+|+.++|||+||+.+++|+|+|++.+. +  .|+|+..+||+++|+|+||||||||||...+.|+|++|+|++.+..
T Consensus        40 ~l~sG~~~~v~I~Yd~~~~~L~V~l~~~~~-~--~p~ls~~vdLs~~l~e~v~VGFSAsTG~~~~~h~IlsWsF~s~l~~  116 (133)
T 1qmo_E           40 DWQNGKIATAHISYNSVSKRLSVTSYYAGS-K--PATLSYDIELHTVLPEWVRVGLSASTGQDKERNTVHSWSFTSSLWT  116 (133)
T ss_dssp             CCCTTSCEEEEEEEETTTTEEEEEEECSSS-C--CEEEEEECCGGGTSCSEEEEEEEEECSSSCCEEEEEEEEEEEEEEE
T ss_pred             EEcCCCEEEEEEEEeCCCcEEEEEEccCCC-c--cceEEEeechHHhccccEEEEEEeccCCCcceeEEEEEEEEeeCCC
Confidence            478999999999999999999999998764 2  7999999999999999999999999999999999999999988753



>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 187
g1qmo.1230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 7e-13
d1v6ia_232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 1e-12
d1qnwa_237 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 2e-12
d1nlsa_237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 2e-12
d1gzca_239 b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( 3e-12
d1hqla_236 b.29.1.1 (A:) Legume lectin {Griffonia simplicifol 2e-11
d1g7ya_253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 2e-11
d1ukga_241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 3e-11
d1avba_226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 6e-11
d1n47a_233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 1e-10
d1f9ka_234 b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca 1e-10
d1leda_243 b.29.1.1 (A:) Legume lectin {West-central african 1e-10
g2ltn.1229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 1e-10
d1ioaa_228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 1e-10
d1g8wa_233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 3e-10
d1fx5a_240 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 5e-10
d1g9fa_251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 5e-10
d2d3sa1237 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso 6e-10
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 1e-09
d1fnya_237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 2e-09
d1dbna_239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 7e-09
d1gv9a_228 b.29.1.13 (A:) Carbohydrate-recognition domain of 0.003
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
d1qnwa_237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 99.81
d1hqla_236 Legume lectin {Griffonia simplicifolia, lectin I-b 99.81
d1gzca_239 Legume lectin {Cockspur coral tree (Erythrina cris 99.81
d1nlsa_237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 99.81
d1g9fa_251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 99.8
d2d3sa1237 Legume lectin {Winged bean (Psophocarpus tetragono 99.8
d1ioaa_228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.8
d1fx5a_240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 99.79
d1leda_243 Legume lectin {West-central african legume (Griffo 99.79
d1f9ka_234 Legume lectin {Winged bean (Psophocarpus tetragono 99.78
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.78
d1ukga_241 Legume lectin {Bloodwood tree (Pterocarpus angolen 99.78
d1g7ya_253 Legume lectin {Horse gram (Dolichos biflorus), dif 99.78
d1n47a_233 Legume lectin {Hairy vetch (Vicia villosa), isolec 99.78
g1qmo.1230 Legume lectin {Field bean (Dolichos lablab), Fril 99.77
d1fnya_237 Legume lectin {Black locust (Robinia pseudoacacia) 99.76
d1v6ia_232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 99.75
d1g8wa_233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.74
d1avba_226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 99.72
d1dbna_239 Legume lectin {Maackia amurensis, leukoagglutinin 99.72
g2ltn.1229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 99.71
d1gv9a_228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 98.83
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 98.06
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 98.03
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 98.03
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 97.98
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 97.95
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 97.9
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 97.9
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 97.89
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 97.88
d2a6va1218 Emp46p N-terminal domain {Baker's yeast (Saccharom 97.86
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 97.86
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 97.84
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 97.83
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 97.83
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 97.83
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 97.82
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 97.82
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 97.8
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 97.79
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 97.79
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 97.79
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 97.79
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 97.78
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 97.78
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 97.76
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 97.76
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 97.76
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 97.74
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 97.74
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 97.73
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 97.72
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 97.72
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 97.71
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 97.7
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 97.7
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 97.69
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 97.69
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 97.69
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 97.68
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 97.66
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 97.65
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 97.62
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 97.58
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 97.57
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 97.56
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 97.55
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 97.54
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 97.53
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 97.51
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 97.5
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 97.49
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 97.48
d2a6za1221 Emp47p N-terminal domain {Baker's yeast (Saccharom 97.48
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 97.46
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 97.34
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 97.33
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 97.31
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 97.28
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 97.27
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 97.18
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 97.17
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 97.16
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 96.98
d1zara2 191 Rio2 serine protein kinase C-terminal domain {Arch 96.84
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Furze (Ulex europaeus), UEA-II [TaxId: 3902]
Probab=99.81  E-value=1.1e-20  Score=154.10  Aligned_cols=77  Identities=30%  Similarity=0.476  Sum_probs=70.7

Q ss_pred             cccCCCceEEEEEEeeCCCceEEEEEEeCCCCCcccceeEEEecCCccCCceeEEEEEeecCCC--ccccceeeeeeccC
Q 047282            6 SDVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVD--FTIFSIYLWEFNSS   83 (187)
Q Consensus         6 ~~l~~G~~~~awI~Yd~~~~~L~V~ls~~~~~~p~~p~ls~~vdLs~~L~~~v~VGFSasTG~~--~~~h~i~sW~F~~~   83 (187)
                      .++.+|+.++|||+||+.+++|+|+|++..  +|..|+|+..+||+++|+++||||||||||..  .|.|+|++|+|+++
T Consensus       158 ~~~~~G~~~~v~I~Yd~~~~~L~V~l~~~~--~~~~p~ls~~vDLs~~l~~~vyvGFSasTG~~~~~q~h~I~sWsF~s~  235 (237)
T d1qnwa_         158 WDWRNGEVADVVITYRAPTKSLTVCLSYPS--DGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSN  235 (237)
T ss_dssp             CCCCTTCCEEEEEEEEGGGTEEEEEEECTT--TCCEEEEEEECCHHHHSCSEEEEEEEEEESCGGGCBCCEEEEEEEEEE
T ss_pred             cccCCCcEEEEEEEEcCCCcEEEEEEecCC--CCccceEEEEEChHHhCCCcEEEEEEeECCCCCCccEeEEEEeEeEEe
Confidence            457899999999999999999999998764  68899999999999999999999999999975  48999999999987


Q ss_pred             C
Q 047282           84 L   84 (187)
Q Consensus        84 ~   84 (187)
                      +
T Consensus       236 l  236 (237)
T d1qnwa_         236 L  236 (237)
T ss_dssp             C
T ss_pred             c
Confidence            5



>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure