Citrus Sinensis ID: 047282
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 187 | ||||||
| 224092745 | 681 | predicted protein [Populus trichocarpa] | 0.711 | 0.195 | 0.407 | 6e-24 | |
| 224096774 | 713 | predicted protein [Populus trichocarpa] | 0.491 | 0.129 | 0.589 | 2e-23 | |
| 225470605 | 720 | PREDICTED: L-type lectin-domain containi | 0.652 | 0.169 | 0.492 | 3e-23 | |
| 356527993 | 709 | PREDICTED: L-type lectin-domain containi | 0.679 | 0.179 | 0.446 | 5e-23 | |
| 356527997 | 709 | PREDICTED: L-type lectin-domain containi | 0.700 | 0.184 | 0.423 | 1e-21 | |
| 224059892 | 613 | predicted protein [Populus trichocarpa] | 0.475 | 0.145 | 0.561 | 2e-21 | |
| 449479047 | 697 | PREDICTED: L-type lectin-domain containi | 0.727 | 0.195 | 0.356 | 3e-21 | |
| 296088135 | 546 | unnamed protein product [Vitis vinifera] | 0.534 | 0.183 | 0.532 | 1e-20 | |
| 449479044 | 678 | PREDICTED: L-type lectin-domain containi | 0.486 | 0.134 | 0.510 | 3e-20 | |
| 449438590 | 665 | PREDICTED: LOW QUALITY PROTEIN: L-type l | 0.486 | 0.136 | 0.510 | 3e-20 |
| >gi|224092745|ref|XP_002334872.1| predicted protein [Populus trichocarpa] gi|222831889|gb|EEE70366.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 115 bits (289), Expect = 6e-24, Method: Compositional matrix adjust.
Identities = 75/184 (40%), Positives = 91/184 (49%), Gaps = 51/184 (27%)
Query: 6 SDVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSME 65
D++ GRR EAWISYNSSTHNLSVAFTG+RNN+V MQ L V LR +LPE V+FGFS
Sbjct: 182 CDIRRGRRTEAWISYNSSTHNLSVAFTGYRNNTVEMQFLSQIVSLRDYLPERVSFGFSAS 241
Query: 66 TGVDFTIFSIYLWEFNSSLE---------------------------------------- 85
TG F I ++Y W+F+SSLE
Sbjct: 242 TGDLFAIHTLYSWDFSSSLEIDDNNRTGLAVGLGVGGGAIVVGAALVGFVIKFMCGHEED 301
Query: 86 ----------MDDETTNPVSNPKRRRKNITALVVRLSLGGGKLGQGGFGGVDKGFLRETN 135
MDDE + PK+ A KLG+GGFGGV KGFL+E +
Sbjct: 302 EEGGHVLEEYMDDEFERG-TGPKKFSYQELARATSNFKDEEKLGEGGFGGVYKGFLKEID 360
Query: 136 SFFS 139
SF +
Sbjct: 361 SFVA 364
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224096774|ref|XP_002334671.1| predicted protein [Populus trichocarpa] gi|222874064|gb|EEF11195.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225470605|ref|XP_002262748.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356527993|ref|XP_003532590.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356527997|ref|XP_003532592.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224059892|ref|XP_002300009.1| predicted protein [Populus trichocarpa] gi|222847267|gb|EEE84814.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449479047|ref|XP_004155490.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|296088135|emb|CBI35556.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449479044|ref|XP_004155489.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449438590|ref|XP_004137071.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 187 | ||||||
| UNIPROTKB|P02870 | 275 | P02870 "Lectin" [Lens culinari | 0.417 | 0.283 | 0.308 | 1.7e-05 | |
| UNIPROTKB|P58907 | 237 | P58907 "Lectin alpha chain" [D | 0.406 | 0.320 | 0.373 | 6.8e-05 | |
| UNIPROTKB|P81637 | 237 | P81637 "Lectin alpha chain" [D | 0.406 | 0.320 | 0.373 | 6.8e-05 | |
| TAIR|locus:2143528 | 711 | AT5G03140 [Arabidopsis thalian | 0.475 | 0.125 | 0.311 | 0.00023 | |
| TAIR|locus:2095390 | 174 | AT3G28230 "AT3G28230" [Arabido | 0.224 | 0.241 | 0.523 | 0.00024 | |
| UNIPROTKB|P83721 | 234 | P83721 "Mannose/glucose-specif | 0.401 | 0.320 | 0.384 | 0.00026 | |
| UNIPROTKB|P81517 | 236 | P81517 "Lectin alpha chain" [C | 0.417 | 0.330 | 0.370 | 0.00026 | |
| UNIPROTKB|P58908 | 237 | P58908 "Lectin alpha chain" [D | 0.406 | 0.320 | 0.361 | 0.00026 | |
| TAIR|locus:2142499 | 651 | AT5G10530 [Arabidopsis thalian | 0.379 | 0.109 | 0.388 | 0.00056 | |
| UNIPROTKB|B3EWJ2 | 237 | B3EWJ2 "Lectin alpha chain" [D | 0.406 | 0.320 | 0.349 | 0.00091 |
| UNIPROTKB|P02870 P02870 "Lectin" [Lens culinaris (taxid:3864)] | Back alignment and assigned GO terms |
|---|
Score = 115 (45.5 bits), Expect = 1.7e-05, P = 1.7e-05
Identities = 25/81 (30%), Positives = 44/81 (54%)
Query: 7 DVKSGRRNEAWISYNSSTHNLSVAFT---GFRNNSVVMQGLDYQVDLRQHLPEFVTFGFS 63
++++G R I++N++T+ L+V T +V L+ V L+ +PE+V GFS
Sbjct: 183 NLQNGERANVVIAFNAATNVLTVTLTYPNSLEEENVTSYTLNEVVPLKDVVPEWVRIGFS 242
Query: 64 METGVDFTIFSIYLWEFNSSL 84
TG +F ++ W F+S L
Sbjct: 243 ATTGAEFAAHEVHSWSFHSEL 263
|
|
| UNIPROTKB|P58907 P58907 "Lectin alpha chain" [Dioclea virgata (taxid:167618)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P81637 P81637 "Lectin alpha chain" [Dioclea guianensis (taxid:99571)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143528 AT5G03140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2095390 AT3G28230 "AT3G28230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P83721 P83721 "Mannose/glucose-specific lectin Cramoll" [Cratylia mollis (taxid:252530)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P81517 P81517 "Lectin alpha chain" [Cratylia argentea (taxid:83131)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P58908 P58908 "Lectin alpha chain" [Dioclea rostrata (taxid:192416)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2142499 AT5G10530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B3EWJ2 B3EWJ2 "Lectin alpha chain" [Dioclea sclerocarpa (taxid:1176036)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.17120001 | hypothetical protein (713 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 187 | |||
| cd06899 | 236 | cd06899, lectin_legume_LecRK_Arcelin_ConA, legume | 9e-16 | |
| pfam00139 | 231 | pfam00139, Lectin_legB, Legume lectin domain | 9e-08 | |
| pfam09368 | 76 | pfam09368, Sas10_Utp3_C, Sas10 C-terminal domain | 6e-05 | |
| cd01951 | 223 | cd01951, lectin_L-type, legume lectins | 3e-04 |
| >gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor | Back alignment and domain information |
|---|
Score = 71.9 bits (177), Expect = 9e-16
Identities = 30/76 (39%), Positives = 39/76 (51%)
Query: 9 KSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGV 68
KSG+ +AWI Y+SS+ LSV L Y VDL + LPE V GFS TG+
Sbjct: 161 KSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGL 220
Query: 69 DFTIFSIYLWEFNSSL 84
+ I W F+S+
Sbjct: 221 LTELHYILSWSFSSNG 236
|
This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236 |
| >gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain | Back alignment and domain information |
|---|
| >gnl|CDD|220207 pfam09368, Sas10_Utp3_C, Sas10 C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|173886 cd01951, lectin_L-type, legume lectins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 187 | |||
| cd06899 | 236 | lectin_legume_LecRK_Arcelin_ConA legume lectins, l | 99.8 | |
| PF00139 | 236 | Lectin_legB: Legume lectin domain; InterPro: IPR00 | 99.77 | |
| cd01951 | 223 | lectin_L-type legume lectins. The L-type (legume-t | 99.56 | |
| cd07308 | 218 | lectin_leg-like legume-like lectins: ERGIC-53, ERG | 98.17 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 97.9 | |
| KOG0595 | 429 | consensus Serine/threonine-protein kinase involved | 97.77 | |
| cd06902 | 225 | lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran | 97.68 | |
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 97.67 | |
| KOG0597 | 808 | consensus Serine-threonine protein kinase FUSED [G | 97.56 | |
| KOG0659 | 318 | consensus Cdk activating kinase (CAK)/RNA polymera | 97.53 | |
| PF09368 | 76 | Sas10: Sas10 C-terminal domain; InterPro: IPR01897 | 97.46 | |
| KOG0593 | 396 | consensus Predicted protein kinase KKIAMRE [Genera | 97.43 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 97.38 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 97.22 | |
| PF00069 | 260 | Pkinase: Protein kinase domain Protein kinase; unc | 97.12 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 97.05 | |
| KOG0594 | 323 | consensus Protein kinase PCTAIRE and related kinas | 96.9 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 96.89 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 96.78 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 96.75 | |
| KOG0575 | 592 | consensus Polo-like serine/threonine protein kinas | 96.72 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 96.71 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 96.7 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 96.69 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 96.68 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 96.67 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 96.67 | |
| PTZ00284 | 467 | protein kinase; Provisional | 96.67 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 96.65 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 96.65 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 96.61 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 96.59 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 96.59 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 96.57 | |
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 96.55 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 96.54 | |
| KOG0662 | 292 | consensus Cyclin-dependent kinase CDK5 [Intracellu | 96.54 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 96.52 | |
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 96.51 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 96.51 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 96.5 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 96.5 | |
| PF03388 | 229 | Lectin_leg-like: Legume-like lectin family; InterP | 96.49 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 96.48 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 96.48 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 96.47 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 96.47 | |
| KOG0591 | 375 | consensus NIMA (never in mitosis)-related G2-speci | 96.46 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 96.44 | |
| KOG4250 | 732 | consensus TANK binding protein kinase TBK1 [Signal | 96.44 | |
| KOG0661 | 538 | consensus MAPK related serine/threonine protein ki | 96.44 | |
| KOG0598 | 357 | consensus Ribosomal protein S6 kinase and related | 96.42 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 96.39 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 96.38 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 96.38 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 96.38 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 96.35 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 96.35 | |
| cd07863 | 288 | STKc_CDK4 Catalytic domain of the Serine/Threonine | 96.33 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 96.32 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 96.32 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 96.31 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 96.31 | |
| cd05084 | 252 | PTKc_Fes Catalytic domain of the Protein Tyrosine | 96.31 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 96.31 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 96.3 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 96.29 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 96.28 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 96.28 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 96.27 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 96.27 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 96.27 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 96.25 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 96.25 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 96.25 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 96.23 | |
| cd08225 | 257 | STKc_Nek5 Catalytic domain of the Protein Serine/T | 96.22 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 96.22 | |
| cd05578 | 258 | STKc_Yank1 Catalytic domain of the Protein Serine/ | 96.21 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 96.2 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 96.19 | |
| cd06632 | 258 | STKc_MEKK1_plant Catalytic domain of the Protein S | 96.19 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 96.18 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 96.18 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 96.18 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 96.17 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 96.16 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 96.16 | |
| cd05085 | 250 | PTKc_Fer Catalytic domain of the Protein Tyrosine | 96.16 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 96.15 | |
| cd06903 | 215 | lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem | 96.14 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 96.14 | |
| cd06606 | 260 | STKc_MAPKKK Catalytic domain of the Protein Serine | 96.12 | |
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 96.11 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 96.11 | |
| cd07840 | 287 | STKc_CDK9_like Catalytic domain of Cyclin-Dependen | 96.11 | |
| cd07836 | 284 | STKc_Pho85 Catalytic domain of the Serine/Threonin | 96.1 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 96.1 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 96.09 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 96.09 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 96.09 | |
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 96.09 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 96.09 | |
| cd07860 | 284 | STKc_CDK2_3 Catalytic domain of the Serine/Threoni | 96.07 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 96.05 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 96.05 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 96.04 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 96.04 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 96.03 | |
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 96.03 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 96.03 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 96.02 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 96.02 | |
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 96.02 | |
| cd05035 | 273 | PTKc_Axl_like Catalytic Domain of Axl-like Protein | 96.02 | |
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 96.01 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 96.01 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 96.0 | |
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 96.0 | |
| cd05147 | 190 | RIO1_euk RIO kinase family; eukaryotic RIO1, catal | 96.0 | |
| cd07830 | 283 | STKc_MAK_like Catalytic domain of Male germ cell-A | 95.99 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 95.99 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 95.98 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 95.98 | |
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 95.97 | |
| cd06630 | 268 | STKc_MEKK1 Catalytic domain of the Protein Serine/ | 95.97 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 95.96 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 95.96 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 95.96 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 95.96 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 95.96 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 95.93 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 95.93 | |
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 95.93 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 95.92 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 95.91 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 95.9 | |
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 95.89 | |
| cd07861 | 285 | STKc_CDK1_euk Catalytic domain of the Serine/Threo | 95.89 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 95.89 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 95.88 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 95.88 | |
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 95.87 | |
| cd06626 | 264 | STKc_MEKK4 Catalytic domain of the Protein Serine/ | 95.87 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 95.85 | |
| KOG0666 | 438 | consensus Cyclin C-dependent kinase CDK8 [Transcri | 95.85 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 95.85 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 95.85 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 95.84 | |
| smart00219 | 258 | TyrKc Tyrosine kinase, catalytic domain. Phosphotr | 95.83 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 95.82 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 95.82 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 95.82 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 95.82 | |
| cd05037 | 259 | PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the | 95.82 | |
| cd05076 | 274 | PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th | 95.82 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 95.81 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 95.8 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 95.79 | |
| cd06901 | 248 | lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr | 95.78 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 95.78 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 95.78 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 95.78 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 95.76 | |
| cd05122 | 253 | PKc_STE Catalytic domain of STE family Protein Kin | 95.76 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 95.76 | |
| cd07842 | 316 | STKc_CDK8_like Catalytic domain of Cyclin-Dependen | 95.75 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 95.75 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 95.75 | |
| cd08529 | 256 | STKc_FA2-like Catalytic domain of the Protein Seri | 95.74 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 95.74 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 95.74 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 95.73 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 95.73 | |
| cd05075 | 272 | PTKc_Axl Catalytic domain of the Protein Tyrosine | 95.73 | |
| cd07839 | 284 | STKc_CDK5 Catalytic domain of the Serine/Threonine | 95.73 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 95.73 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 95.71 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 95.69 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 95.69 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 95.68 | |
| KOG0198 | 313 | consensus MEKK and related serine/threonine protei | 95.68 | |
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 95.67 | |
| cd07835 | 283 | STKc_CDK1_like Catalytic domain of Cyclin-Dependen | 95.67 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 95.67 | |
| KOG3838 | 497 | consensus Mannose lectin ERGIC-53, involved in gly | 95.66 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 95.66 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 95.66 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 95.65 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 95.65 | |
| cd07832 | 286 | STKc_CCRK Catalytic domain of the Serine/Threonine | 95.65 | |
| cd05041 | 251 | PTKc_Fes_like Catalytic domain of Fes-like Protein | 95.64 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 95.63 | |
| KOG0201 | 467 | consensus Serine/threonine protein kinase [Signal | 95.63 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 95.62 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 95.62 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 95.62 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 95.61 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 95.59 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 95.58 | |
| cd05058 | 262 | PTKc_Met_Ron Catalytic domain of the Protein Tyros | 95.58 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 95.57 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 95.57 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 95.56 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 95.56 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 95.56 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 95.54 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 95.54 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 95.54 | |
| cd05074 | 273 | PTKc_Tyro3 Catalytic domain of the Protein Tyrosin | 95.53 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 95.53 | |
| cd05145 | 190 | RIO1_like RIO kinase family; RIO1, RIO3 and simila | 95.52 | |
| cd06631 | 265 | STKc_YSK4 Catalytic domain of the Protein Serine/T | 95.51 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 95.51 | |
| cd08220 | 256 | STKc_Nek8 Catalytic domain of the Protein Serine/T | 95.49 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 95.49 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 95.48 | |
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 95.47 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 95.46 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 95.46 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 95.46 | |
| cd05077 | 262 | PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th | 95.45 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 95.45 | |
| cd00192 | 262 | PTKc Catalytic domain of Protein Tyrosine Kinases. | 95.44 | |
| cd05115 | 257 | PTKc_Zap-70 Catalytic domain of the Protein Tyrosi | 95.43 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 95.41 | |
| cd05060 | 257 | PTKc_Syk_like Catalytic domain of Spleen Tyrosine | 95.41 | |
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 95.4 | |
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 95.4 | |
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 95.4 | |
| cd08218 | 256 | STKc_Nek1 Catalytic domain of the Protein Serine/T | 95.4 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 95.39 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 95.38 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 95.38 | |
| cd05040 | 257 | PTKc_Ack_like Catalytic domain of the Protein Tyro | 95.37 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 95.36 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 95.36 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 95.36 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 95.36 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 95.33 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 95.33 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 95.33 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 95.32 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 95.31 | |
| cd06628 | 267 | STKc_MAPKKK_Byr2_like Catalytic domain of fungal B | 95.28 | |
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 95.28 | |
| cd05116 | 257 | PTKc_Syk Catalytic domain of the Protein Tyrosine | 95.28 | |
| smart00221 | 225 | STYKc Protein kinase; unclassified specificity. Ph | 95.27 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 95.26 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 95.26 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 95.26 | |
| cd05123 | 250 | STKc_AGC Catalytic domain of AGC family Protein Se | 95.25 | |
| KOG0581 | 364 | consensus Mitogen-activated protein kinase kinase | 95.24 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 95.23 | |
| cd08215 | 258 | STKc_Nek Catalytic domain of the Protein Serine/Th | 95.22 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 95.22 | |
| KOG0660 | 359 | consensus Mitogen-activated protein kinase [Signal | 95.21 | |
| cd05078 | 258 | PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain | 95.21 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 95.19 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 95.19 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 95.19 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 95.18 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 95.17 | |
| cd06627 | 254 | STKc_Cdc7_like Catalytic domain of Cell division c | 95.17 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 95.15 | |
| cd07831 | 282 | STKc_MOK Catalytic domain of the Serine/Threonine | 95.14 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 95.13 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 95.13 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 95.12 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 95.12 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 95.12 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 95.11 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 95.1 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 95.1 | |
| cd08217 | 265 | STKc_Nek2 Catalytic domain of the Protein Serine/T | 95.09 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 95.08 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 95.06 | |
| cd05118 | 283 | STKc_CMGC Catalytic domain of CMGC family Serine/T | 95.05 | |
| KOG0583 | 370 | consensus Serine/threonine protein kinase [Signal | 95.02 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 95.02 | |
| cd05119 | 187 | RIO RIO kinase family, catalytic domain. The RIO k | 95.02 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 94.99 | |
| cd05047 | 270 | PTKc_Tie Catalytic domain of Tie Protein Tyrosine | 94.99 | |
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 94.99 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 94.98 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 94.97 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 94.96 | |
| cd05087 | 269 | PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein | 94.96 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 94.94 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 94.94 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 94.94 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 94.92 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 94.9 | |
| KOG0669 | 376 | consensus Cyclin T-dependent kinase CDK9 [Cell cyc | 94.9 | |
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 94.88 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 94.87 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 94.87 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 94.86 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 94.82 | |
| cd07838 | 287 | STKc_CDK4_6_like Catalytic domain of Cyclin-Depend | 94.78 | |
| cd08221 | 256 | STKc_Nek9 Catalytic domain of the Protein Serine/T | 94.77 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 94.75 | |
| cd08223 | 257 | STKc_Nek4 Catalytic domain of the Protein Serine/T | 94.75 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 94.75 | |
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 94.73 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 94.73 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 94.73 | |
| cd05045 | 290 | PTKc_RET Catalytic domain of the Protein Tyrosine | 94.73 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 94.72 | |
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 94.69 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 94.69 | |
| cd08219 | 255 | STKc_Nek3 Catalytic domain of the Protein Serine/T | 94.66 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 94.63 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 94.63 | |
| cd05044 | 269 | PTKc_c-ros Catalytic domain of the Protein Tyrosin | 94.62 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 94.55 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 94.52 | |
| cd00180 | 215 | PKc Catalytic domain of Protein Kinases. Protein K | 94.5 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 94.45 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 94.44 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 94.43 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 94.42 | |
| cd05042 | 269 | PTKc_Aatyk Catalytic domain of the Protein Tyrosin | 94.35 | |
| cd07829 | 282 | STKc_CDK_like Catalytic domain of Cyclin-Dependent | 94.31 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 94.3 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 94.28 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 94.28 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 94.22 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 94.16 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 94.15 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 94.14 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 94.13 | |
| cd08530 | 256 | STKc_CNK2-like Catalytic domain of the Protein Ser | 94.11 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 94.06 | |
| KOG1989 | 738 | consensus ARK protein kinase family [Signal transd | 93.99 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 93.96 | |
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 93.95 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 93.91 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 93.83 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 93.81 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 93.75 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 93.75 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 93.72 | |
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 93.57 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 93.45 | |
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 93.45 | |
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 93.44 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 93.42 | |
| cd08528 | 269 | STKc_Nek10 Catalytic domain of the Protein Serine/ | 93.41 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 93.28 | |
| KOG0616 | 355 | consensus cAMP-dependent protein kinase catalytic | 93.24 | |
| KOG0592 | 604 | consensus 3-phosphoinositide-dependent protein kin | 93.23 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 93.05 | |
| KOG0578 | 550 | consensus p21-activated serine/threonine protein k | 93.03 | |
| KOG0582 | 516 | consensus Ste20-like serine/threonine protein kina | 92.97 | |
| cd08222 | 260 | STKc_Nek11 Catalytic domain of the Protein Serine/ | 92.95 | |
| KOG0587 | 953 | consensus Traf2- and Nck-interacting kinase and re | 92.9 | |
| cd05086 | 268 | PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi | 92.88 | |
| KOG0986 | 591 | consensus G protein-coupled receptor kinase [Signa | 92.8 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 92.75 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 92.72 | |
| PF03109 | 119 | ABC1: ABC1 family; InterPro: IPR004147 This entry | 92.59 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 92.57 | |
| KOG4279 | 1226 | consensus Serine/threonine protein kinase [Signal | 92.44 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 92.22 | |
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 92.15 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 92.09 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 91.91 | |
| KOG3118 | 517 | consensus Disrupter of silencing SAS10 [Chromatin | 91.73 | |
| KOG1163 | 341 | consensus Casein kinase (serine/threonine/tyrosine | 91.69 | |
| smart00090 | 237 | RIO RIO-like kinase. | 91.66 | |
| KOG2345 | 302 | consensus Serine/threonine protein kinase/TGF-beta | 91.6 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 91.52 | |
| KOG0585 | 576 | consensus Ca2+/calmodulin-dependent protein kinase | 91.47 | |
| KOG0610 | 459 | consensus Putative serine/threonine protein kinase | 91.46 | |
| KOG0586 | 596 | consensus Serine/threonine protein kinase [General | 91.46 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 91.41 | |
| smart00220 | 244 | S_TKc Serine/Threonine protein kinases, catalytic | 91.31 | |
| KOG4278 | 1157 | consensus Protein tyrosine kinase [Signal transduc | 91.3 | |
| PRK10345 | 210 | hypothetical protein; Provisional | 91.3 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 91.24 | |
| PRK14879 | 211 | serine/threonine protein kinase; Provisional | 90.72 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 90.64 | |
| cd06900 | 255 | lectin_VcfQ VcfQ bacterial pilus biogenesis protei | 90.58 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 90.46 | |
| TIGR03724 | 199 | arch_bud32 Kae1-associated kinase Bud32. Members o | 90.18 | |
| KOG0588 | 786 | consensus Serine/threonine protein kinase [Cell cy | 89.78 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 89.73 | |
| KOG4721 | 904 | consensus Serine/threonine protein kinase, contain | 89.12 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 89.04 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 88.85 | |
| KOG0033 | 355 | consensus Ca2+/calmodulin-dependent protein kinase | 88.82 | |
| KOG0589 | 426 | consensus Serine/threonine protein kinase [General | 88.45 | |
| KOG0611 | 668 | consensus Predicted serine/threonine protein kinas | 87.68 | |
| KOG3839 | 351 | consensus Lectin VIP36, involved in the transport | 87.48 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 87.36 | |
| KOG0668 | 338 | consensus Casein kinase II, alpha subunit [Signal | 86.83 | |
| KOG0671 | 415 | consensus LAMMER dual specificity kinases [Signal | 85.56 | |
| KOG1164 | 322 | consensus Casein kinase (serine/threonine/tyrosine | 85.12 | |
| cd05120 | 155 | APH_ChoK_like Aminoglycoside 3'-phosphotransferase | 83.66 | |
| KOG4257 | 974 | consensus Focal adhesion tyrosine kinase FAK, cont | 83.61 | |
| KOG0983 | 391 | consensus Mitogen-activated protein kinase (MAPK) | 82.45 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 82.28 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 80.87 | |
| PF14531 | 288 | Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ | 80.35 |
| >cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor | Back alignment and domain information |
|---|
Probab=99.80 E-value=1.6e-19 Score=150.39 Aligned_cols=77 Identities=39% Similarity=0.568 Sum_probs=72.7
Q ss_pred ccCCCceEEEEEEeeCCCceEEEEEEeCCCCCcccceeEEEecCCccCCceeEEEEEeecCCCccccceeeeeeccC
Q 047282 7 DVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNSS 83 (187)
Q Consensus 7 ~l~~G~~~~awI~Yd~~~~~L~V~ls~~~~~~p~~p~ls~~vdLs~~L~~~v~VGFSasTG~~~~~h~i~sW~F~~~ 83 (187)
+|.+|+.++|||+||+.+++|+|+|.+.+..+|..|+|+..+||+++|+++|||||||+||...+.|+|++|+|++.
T Consensus 159 ~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~sWsF~s~ 235 (236)
T cd06899 159 KLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSSN 235 (236)
T ss_pred cccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEEEEEEEcC
Confidence 36799999999999999999999999887668999999999999999999999999999999999999999999875
|
This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin |
| >PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported | Back alignment and domain information |
|---|
| >cd01951 lectin_L-type legume lectins | Back alignment and domain information |
|---|
| >cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF09368 Sas10: Sas10 C-terminal domain; InterPro: IPR018972 This entry represents the C-terminal domain of the Something about silencing protein 10 (Sas10), which is essential for gene silencing and has a role in the structure of silenced chromatin [, ] | Back alignment and domain information |
|---|
| >KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain | Back alignment and domain information |
|---|
| >cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >smart00219 TyrKc Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd05122 PKc_STE Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain | Back alignment and domain information |
|---|
| >cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >smart00221 STYKc Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd05119 RIO RIO kinase family, catalytic domain | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >cd00180 PKc Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >KOG3118 consensus Disrupter of silencing SAS10 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0586 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10345 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >PRK14879 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >TIGR03724 arch_bud32 Kae1-associated kinase Bud32 | Back alignment and domain information |
|---|
| >KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0589 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family | Back alignment and domain information |
|---|
| >KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 187 | ||||
| 1mvq_A | 236 | Cratylia Mollis Lectin (Isoform 1) In Complex With | 2e-05 | ||
| 3rrd_A | 237 | Native Structure Of Dioclea Virgata Lectin Length = | 3e-05 | ||
| 1h9w_A | 237 | Native Dioclea Guianensis Seed Lectin Length = 237 | 3e-05 | ||
| 1h9p_A | 237 | Crystal Structure Of Dioclea Guianensis Seed Lectin | 3e-05 | ||
| 3u4x_A | 236 | Crystal Structure Of A Lectin From Camptosema Pedic | 3e-05 | ||
| 1hql_A | 257 | The Xenograft Antigen In Complex With The B4 Isolec | 5e-05 | ||
| 1gnz_A | 257 | Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)m | 6e-05 | ||
| 2jdz_A | 239 | Crystal Structure Of Recombinant Dioclea Guianensis | 6e-05 | ||
| 2je7_A | 239 | Crystal Structure Of Recombinant Dioclea Guianensis | 6e-05 | ||
| 1n3o_A | 252 | Pterocarcpus Angolensis Lectin In Complex With Alph | 7e-05 | ||
| 1q8o_A | 252 | Pterocartpus Angolensis Lectin Pal In Complex With | 7e-05 | ||
| 1qmo_E | 133 | Structure Of Fril, A Legume Lectin That Delays Hema | 7e-05 | ||
| 2bqp_A | 234 | The Structure Of The Pea Lectin-D-Glucopyranose Com | 8e-05 | ||
| 2d3p_A | 236 | Cratylia Floribunda Seed Lectin Crystallized At Bas | 9e-05 | ||
| 2zbj_A | 237 | Crystal Structure Of Dioclea Rostrata Lectin Length | 9e-05 | ||
| 1bjq_A | 253 | The Dolichos Biflorus Seed Lectin In Complex With A | 1e-04 | ||
| 3a0k_A | 237 | Crystal Structure Of An Antiflamatory Legume Lectin | 2e-04 | ||
| 1lul_A | 253 | Db58, A Legume Lectin From Dolichos Biflorus Length | 2e-04 | ||
| 2jec_A | 239 | Crystal Structure Of Recombinant Dioclea Grandiflor | 2e-04 | ||
| 1dgl_A | 237 | Lectin From Dioclea Grandiflora Complexed To Triman | 3e-04 | ||
| 2je9_A | 239 | Crystal Structure Of Recombinant Dioclea Grandiflor | 3e-04 | ||
| 3sh3_A | 237 | Crystal Structure Of A Pro-Inflammatory Lectin From | 3e-04 | ||
| 2gdf_A | 237 | Crystal Structure Of Dioclea Violacea Seed Lectin L | 3e-04 | ||
| 2fmd_A | 240 | Structural Basis Of Carbohydrate Recognition By Bow | 3e-04 |
| >pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 | Back alignment and structure |
|
| >pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 | Back alignment and structure |
| >pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 | Back alignment and structure |
| >pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 | Back alignment and structure |
| >pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 | Back alignment and structure |
| >pdb|1HQL|A Chain A, The Xenograft Antigen In Complex With The B4 Isolectin Of Griffonia Simplicifolia Lectin-1 Length = 257 | Back alignment and structure |
| >pdb|1GNZ|A Chain A, Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)metal Free Form Length = 257 | Back alignment and structure |
| >pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 | Back alignment and structure |
| >pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 | Back alignment and structure |
| >pdb|1QMO|E Chain E, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 133 | Back alignment and structure |
| >pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 | Back alignment and structure |
| >pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 | Back alignment and structure |
| >pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 | Back alignment and structure |
| >pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 | Back alignment and structure |
| >pdb|3A0K|A Chain A, Crystal Structure Of An Antiflamatory Legume Lectin From Cymbosema Roseum Seeds Length = 237 | Back alignment and structure |
| >pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 | Back alignment and structure |
| >pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 | Back alignment and structure |
| >pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 | Back alignment and structure |
| >pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 | Back alignment and structure |
| >pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 187 | |||
| 1qmo_E | 133 | Mannose binding lectin, FRIL; crosslink, hematopoi | 2e-13 | |
| 2fmd_A | 240 | Lectin, agglutinin, BMA; legume lectin, beta sandw | 8e-12 | |
| 3zyr_A | 261 | Lectin; sugar binding protein, N-glycan; HET: NAG | 1e-11 | |
| 1dhk_B | 223 | Bean lectin-like inhibitor, porcine pancreatic alp | 1e-11 | |
| 1avb_A | 226 | Arcelin-1; lectin-like glycoprotein, plant defense | 2e-11 | |
| 1v6i_A | 232 | Agglutinin, PNA, galactose-binding lectin; open qu | 1e-10 | |
| 1gzc_A | 239 | Erythrina crista-galli lectin; carbohydrate, sugar | 2e-10 | |
| 1fat_A | 252 | Phytohemagglutinin-L; glycoprotein, plant defense | 2e-10 | |
| 1wbf_A | 242 | Protein (agglutinin); lectin (agglutinin), legume | 5e-10 | |
| 3ipv_A | 251 | Lectin alpha chain; galactose binding, SEED lectin | 5e-10 | |
| 1n47_A | 233 | Isolectin B4; cancer antigen, vicia villosa lectin | 6e-10 | |
| 1g7y_A | 253 | Stem/LEAF lectin DB58; jelly roll fold, sugar bind | 7e-10 | |
| 1ioa_A | 240 | Arcelin-5A, ARC5A; lectin-like proteins, plant def | 7e-10 | |
| 2ltn_B | 52 | PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP | 9e-10 | |
| 1qnw_A | 242 | Chitin binding lectin, UEA-II; carbohydrate bindin | 1e-09 | |
| 1fny_A | 237 | BARK lectin, BARK agglutinin I,polypeptide A; legu | 1e-09 | |
| 1hql_A | 257 | Lectin; xenograft antigen, sugar BI protein; HET: | 2e-09 | |
| 2bqp_A | 234 | Protein (PEA lectin); D-glucopyranose complex, sug | 2e-09 | |
| 2eig_A | 234 | Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin | 2e-09 | |
| 1gsl_A | 243 | Griffonia simplicifolia lectin 4; glycoprotein, ma | 3e-09 | |
| 1dbn_A | 239 | MAL, protein (leukoagglutinin); plant lectin, carb | 7e-09 | |
| 1fx5_A | 242 | UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO | 9e-09 | |
| 1sbf_A | 253 | Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G | 1e-08 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 2e-08 | |
| 1f9k_A | 238 | Acidic lectin; legume lectin, glycosylated protein | 3e-08 |
| >1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 | Back alignment and structure |
|---|
Score = 63.2 bits (153), Expect = 2e-13
Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 9/101 (8%)
Query: 9 KSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGV 68
++G+ A ISYNS + LSV + L Y ++L LPE+V G S TG
Sbjct: 42 QNGKIATAHISYNSVSKRLSVTSYYAGSKPAT---LSYDIELHTVLPEWVRVGLSASTGQ 98
Query: 69 DFTIFSIYLWEFNSSLEMDDETTNPVSNPKRRRKNITALVV 109
D +++ W F SSL V+ + K IT V+
Sbjct: 99 DKERNTVHSWSFTSSLW------TNVAKKENENKYITRGVL 133
|
| >2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 | Back alignment and structure |
|---|
| >3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 | Back alignment and structure |
|---|
| >1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 | Back alignment and structure |
|---|
| >1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 | Back alignment and structure |
|---|
| >1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 | Back alignment and structure |
|---|
| >1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 | Back alignment and structure |
|---|
| >1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 | Back alignment and structure |
|---|
| >1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 | Back alignment and structure |
|---|
| >3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 | Back alignment and structure |
|---|
| >1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 | Back alignment and structure |
|---|
| >1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 | Back alignment and structure |
|---|
| >1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 | Back alignment and structure |
|---|
| >2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 | Back alignment and structure |
|---|
| >1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 | Back alignment and structure |
|---|
| >1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 | Back alignment and structure |
|---|
| >1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 | Back alignment and structure |
|---|
| >2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 | Back alignment and structure |
|---|
| >2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 | Back alignment and structure |
|---|
| >1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 | Back alignment and structure |
|---|
| >1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 | Back alignment and structure |
|---|
| >1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 | Back alignment and structure |
|---|
| >1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 | Back alignment and structure |
|---|
| >1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 187 | |||
| 1qmo_E | 133 | Mannose binding lectin, FRIL; crosslink, hematopoi | 99.89 | |
| 1dhk_B | 223 | Bean lectin-like inhibitor, porcine pancreatic alp | 99.85 | |
| 3ipv_A | 251 | Lectin alpha chain; galactose binding, SEED lectin | 99.85 | |
| 1hql_A | 257 | Lectin; xenograft antigen, sugar BI protein; HET: | 99.85 | |
| 1ioa_A | 240 | Arcelin-5A, ARC5A; lectin-like proteins, plant def | 99.85 | |
| 3ujo_A | 281 | Legume lectin; carbohydrate-binding, galactose, ad | 99.84 | |
| 1avb_A | 226 | Arcelin-1; lectin-like glycoprotein, plant defense | 99.84 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 99.84 | |
| 2bqp_A | 234 | Protein (PEA lectin); D-glucopyranose complex, sug | 99.84 | |
| 3zyr_A | 261 | Lectin; sugar binding protein, N-glycan; HET: NAG | 99.84 | |
| 1dbn_A | 239 | MAL, protein (leukoagglutinin); plant lectin, carb | 99.83 | |
| 1fny_A | 237 | BARK lectin, BARK agglutinin I,polypeptide A; legu | 99.83 | |
| 1fx5_A | 242 | UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO | 99.83 | |
| 1n47_A | 233 | Isolectin B4; cancer antigen, vicia villosa lectin | 99.83 | |
| 1qnw_A | 242 | Chitin binding lectin, UEA-II; carbohydrate bindin | 99.83 | |
| 1gzc_A | 239 | Erythrina crista-galli lectin; carbohydrate, sugar | 99.83 | |
| 2eig_A | 234 | Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin | 99.82 | |
| 1sbf_A | 253 | Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G | 99.82 | |
| 1g7y_A | 253 | Stem/LEAF lectin DB58; jelly roll fold, sugar bind | 99.82 | |
| 1fat_A | 252 | Phytohemagglutinin-L; glycoprotein, plant defense | 99.82 | |
| 1wbf_A | 242 | Protein (agglutinin); lectin (agglutinin), legume | 99.82 | |
| 1f9k_A | 238 | Acidic lectin; legume lectin, glycosylated protein | 99.82 | |
| 2fmd_A | 240 | Lectin, agglutinin, BMA; legume lectin, beta sandw | 99.81 | |
| 1v6i_A | 232 | Agglutinin, PNA, galactose-binding lectin; open qu | 99.8 | |
| 1gsl_A | 243 | Griffonia simplicifolia lectin 4; glycoprotein, ma | 99.8 | |
| 2ltn_B | 52 | PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP | 99.63 | |
| 1gv9_A | 260 | P58/ergic-53; lectin, carbohydrate binding; 1.46A | 99.46 | |
| 2dur_A | 253 | VIP36;, vesicular integral-membrane protein VIP36; | 99.45 | |
| 2a6y_A | 256 | EMP47P (FORM1); beta sandwich, carbohydrate bindin | 98.97 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 98.02 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 97.99 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 97.97 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 97.96 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 97.91 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 97.87 | |
| 2a6z_A | 222 | EMP47P (FORM2); beta sandwich, carbohydrate bindin | 97.85 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 97.81 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 97.79 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 97.79 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 97.77 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 97.76 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 97.73 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 97.7 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 97.48 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 97.48 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 97.43 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 97.37 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 97.37 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 97.32 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 97.3 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 97.26 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 97.24 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 97.24 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 97.24 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 97.23 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 97.22 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 97.21 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 97.19 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 97.19 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 97.18 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 97.17 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 97.16 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 97.15 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 97.13 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 97.12 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 97.11 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 97.11 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 97.11 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 97.1 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 97.08 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 97.08 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 97.07 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 97.07 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 97.06 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 97.06 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 97.06 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 97.05 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 97.05 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 97.05 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 97.03 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 97.03 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 97.02 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 97.02 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 97.02 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 97.01 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 97.01 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 97.0 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 96.99 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 96.99 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 96.99 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 96.98 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 96.98 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 96.98 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 96.98 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 96.96 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 96.96 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 96.96 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 96.96 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 96.95 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 96.95 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 96.95 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 96.95 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 96.95 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 96.95 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 96.95 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 96.94 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 96.94 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 96.93 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 96.93 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 96.93 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 96.92 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 96.92 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 96.92 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 96.91 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 96.91 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 96.91 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 96.9 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 96.9 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 96.9 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 96.9 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 96.9 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 96.9 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 96.89 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 96.89 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 96.89 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 96.89 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 96.88 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 96.88 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 96.87 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 96.87 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 96.87 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 96.87 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 96.86 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 96.85 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 96.84 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 96.84 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 96.84 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 96.83 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 96.83 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 96.83 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 96.83 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 96.83 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 96.82 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 96.82 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 96.82 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 96.82 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 96.82 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 96.82 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 96.81 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 96.81 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 96.81 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 96.8 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 96.8 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 96.8 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 96.78 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 96.78 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 96.78 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 96.77 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 96.77 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 96.77 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 96.76 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 96.76 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 96.76 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 96.75 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 96.75 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 96.74 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 96.74 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 96.74 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 96.73 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 96.73 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 96.72 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 96.72 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 96.72 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 96.72 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 96.72 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 96.71 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 96.71 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 96.71 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 96.71 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 96.7 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 96.7 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 96.68 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 96.68 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 96.67 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 96.67 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 96.67 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 96.67 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 96.66 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 96.65 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 96.65 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 96.64 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 96.64 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 96.6 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 96.6 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 96.6 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 96.6 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 96.58 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 96.58 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 96.57 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 96.57 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 96.57 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 96.56 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 96.56 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 96.54 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 96.54 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 96.54 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 96.54 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 96.53 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 96.53 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 96.52 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 96.52 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 96.51 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 96.51 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 96.5 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 96.5 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 96.5 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 96.5 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 96.5 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 96.49 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 96.48 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 96.48 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 96.48 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 96.45 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 96.45 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 96.45 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 96.44 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 96.44 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 96.44 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 96.43 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 96.43 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 96.42 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 96.42 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 96.42 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 96.4 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 96.39 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 96.38 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 96.38 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 96.37 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 96.32 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 96.3 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 96.29 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 96.29 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 96.28 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 96.28 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 96.28 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 96.26 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 96.26 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 96.26 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 96.25 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 96.23 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 96.22 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 96.19 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 96.17 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 96.16 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 96.16 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 96.15 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 96.12 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 96.1 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 96.07 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 96.05 | |
| 2a6v_A | 226 | EMP46P; beta sandwich, carbohydrate binding protei | 96.04 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 96.01 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 96.01 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 96.0 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 96.0 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 95.98 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 95.89 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 95.82 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 95.81 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 95.79 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 95.76 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 95.74 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 95.59 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 95.56 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 95.54 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 95.5 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 95.44 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 95.28 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 95.2 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 95.07 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 94.9 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 94.33 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 93.61 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 92.52 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 91.76 |
| >1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 | Back alignment and structure |
|---|
Probab=99.89 E-value=1.9e-23 Score=159.02 Aligned_cols=77 Identities=36% Similarity=0.488 Sum_probs=71.3
Q ss_pred ccCCCceEEEEEEeeCCCceEEEEEEeCCCCCcccceeEEEecCCccCCceeEEEEEeecCCCccccceeeeeeccCCCC
Q 047282 7 DVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVDFTIFSIYLWEFNSSLEM 86 (187)
Q Consensus 7 ~l~~G~~~~awI~Yd~~~~~L~V~ls~~~~~~p~~p~ls~~vdLs~~L~~~v~VGFSasTG~~~~~h~i~sW~F~~~~~~ 86 (187)
+|.+|+.++|||+||+.+++|+|+|++.+. + .|+|+..+||+++|+|+||||||||||...+.|+|++|+|++.+..
T Consensus 40 ~l~sG~~~~v~I~Yd~~~~~L~V~l~~~~~-~--~p~ls~~vdLs~~l~e~v~VGFSAsTG~~~~~h~IlsWsF~s~l~~ 116 (133)
T 1qmo_E 40 DWQNGKIATAHISYNSVSKRLSVTSYYAGS-K--PATLSYDIELHTVLPEWVRVGLSASTGQDKERNTVHSWSFTSSLWT 116 (133)
T ss_dssp CCCTTSCEEEEEEEETTTTEEEEEEECSSS-C--CEEEEEECCGGGTSCSEEEEEEEEECSSSCCEEEEEEEEEEEEEEE
T ss_pred EEcCCCEEEEEEEEeCCCcEEEEEEccCCC-c--cceEEEeechHHhccccEEEEEEeccCCCcceeEEEEEEEEeeCCC
Confidence 478999999999999999999999998764 2 7999999999999999999999999999999999999999988753
|
| >1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* | Back alignment and structure |
|---|
| >3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* | Back alignment and structure |
|---|
| >1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* | Back alignment and structure |
|---|
| >1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* | Back alignment and structure |
|---|
| >1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... | Back alignment and structure |
|---|
| >2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... | Back alignment and structure |
|---|
| >1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* | Back alignment and structure |
|---|
| >1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* | Back alignment and structure |
|---|
| >1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* | Back alignment and structure |
|---|
| >1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* | Back alignment and structure |
|---|
| >2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} | Back alignment and structure |
|---|
| >1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* | Back alignment and structure |
|---|
| >1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* | Back alignment and structure |
|---|
| >1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* | Back alignment and structure |
|---|
| >1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* | Back alignment and structure |
|---|
| >1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* | Back alignment and structure |
|---|
| >2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} | Back alignment and structure |
|---|
| >1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... | Back alignment and structure |
|---|
| >1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* | Back alignment and structure |
|---|
| >2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B | Back alignment and structure |
|---|
| >1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A | Back alignment and structure |
|---|
| >2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* | Back alignment and structure |
|---|
| >2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 187 | ||||
| g1qmo.1 | 230 | b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich | 7e-13 | |
| d1v6ia_ | 232 | b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog | 1e-12 | |
| d1qnwa_ | 237 | b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus | 2e-12 | |
| d1nlsa_ | 237 | b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia | 2e-12 | |
| d1gzca_ | 239 | b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( | 3e-12 | |
| d1hqla_ | 236 | b.29.1.1 (A:) Legume lectin {Griffonia simplicifol | 2e-11 | |
| d1g7ya_ | 253 | b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos | 2e-11 | |
| d1ukga_ | 241 | b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero | 3e-11 | |
| d1avba_ | 226 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 6e-11 | |
| d1n47a_ | 233 | b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi | 1e-10 | |
| d1f9ka_ | 234 | b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca | 1e-10 | |
| d1leda_ | 243 | b.29.1.1 (A:) Legume lectin {West-central african | 1e-10 | |
| g2ltn.1 | 229 | b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum | 1e-10 | |
| d1ioaa_ | 228 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 1e-10 | |
| d1g8wa_ | 233 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 3e-10 | |
| d1fx5a_ | 240 | b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus | 5e-10 | |
| d1g9fa_ | 251 | b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) | 5e-10 | |
| d2d3sa1 | 237 | b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso | 6e-10 | |
| d1dhkb_ | 204 | b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar | 1e-09 | |
| d1fnya_ | 237 | b.29.1.1 (A:) Legume lectin {Black locust (Robinia | 2e-09 | |
| d1dbna_ | 239 | b.29.1.1 (A:) Legume lectin {Maackia amurensis, le | 7e-09 | |
| d1gv9a_ | 228 | b.29.1.13 (A:) Carbohydrate-recognition domain of | 0.003 |
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 | Back information, alignment and structure |
|---|
| >d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 | Back information, alignment and structure |
|---|
| >d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 | Back information, alignment and structure |
|---|
| >d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 | Back information, alignment and structure |
|---|
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 | Back information, alignment and structure |
|---|
| >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 | Back information, alignment and structure |
|---|
| >d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 | Back information, alignment and structure |
|---|
| >d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 | Back information, alignment and structure |
|---|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 | Back information, alignment and structure |
|---|
| >d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 | Back information, alignment and structure |
|---|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 187 | |||
| d1qnwa_ | 237 | Legume lectin {Furze (Ulex europaeus), UEA-II [Tax | 99.81 | |
| d1hqla_ | 236 | Legume lectin {Griffonia simplicifolia, lectin I-b | 99.81 | |
| d1gzca_ | 239 | Legume lectin {Cockspur coral tree (Erythrina cris | 99.81 | |
| d1nlsa_ | 237 | Concanavalin A {Jack bean (Canavalia ensiformis) [ | 99.81 | |
| d1g9fa_ | 251 | Legume lectin {Soybean (Glycine max) [TaxId: 3847] | 99.8 | |
| d2d3sa1 | 237 | Legume lectin {Winged bean (Psophocarpus tetragono | 99.8 | |
| d1ioaa_ | 228 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.8 | |
| d1fx5a_ | 240 | Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI | 99.79 | |
| d1leda_ | 243 | Legume lectin {West-central african legume (Griffo | 99.79 | |
| d1f9ka_ | 234 | Legume lectin {Winged bean (Psophocarpus tetragono | 99.78 | |
| d1dhkb_ | 204 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.78 | |
| d1ukga_ | 241 | Legume lectin {Bloodwood tree (Pterocarpus angolen | 99.78 | |
| d1g7ya_ | 253 | Legume lectin {Horse gram (Dolichos biflorus), dif | 99.78 | |
| d1n47a_ | 233 | Legume lectin {Hairy vetch (Vicia villosa), isolec | 99.78 | |
| g1qmo.1 | 230 | Legume lectin {Field bean (Dolichos lablab), Fril | 99.77 | |
| d1fnya_ | 237 | Legume lectin {Black locust (Robinia pseudoacacia) | 99.76 | |
| d1v6ia_ | 232 | Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 | 99.75 | |
| d1g8wa_ | 233 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.74 | |
| d1avba_ | 226 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 99.72 | |
| d1dbna_ | 239 | Legume lectin {Maackia amurensis, leukoagglutinin | 99.72 | |
| g2ltn.1 | 229 | Legume lectin {Garden pea (Pisum sativum) [TaxId: | 99.71 | |
| d1gv9a_ | 228 | Carbohydrate-recognition domain of P58/ERGIC-53 {R | 98.83 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 98.06 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 98.03 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 98.03 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 97.98 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 97.95 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 97.9 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 97.9 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 97.89 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 97.88 | |
| d2a6va1 | 218 | Emp46p N-terminal domain {Baker's yeast (Saccharom | 97.86 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 97.86 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 97.84 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 97.83 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 97.83 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 97.83 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 97.82 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 97.82 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 97.8 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 97.79 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 97.79 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 97.79 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 97.79 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 97.78 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 97.78 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 97.76 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 97.76 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 97.76 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 97.74 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 97.74 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 97.73 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 97.72 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 97.72 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 97.71 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 97.7 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 97.7 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 97.69 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 97.69 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 97.69 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 97.68 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 97.66 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 97.65 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 97.62 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 97.58 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 97.57 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 97.56 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 97.55 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 97.54 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 97.53 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 97.51 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 97.5 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 97.5 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 97.49 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 97.48 | |
| d2a6za1 | 221 | Emp47p N-terminal domain {Baker's yeast (Saccharom | 97.48 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 97.46 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 97.34 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 97.33 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 97.31 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 97.28 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 97.27 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 97.18 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 97.17 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 97.16 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 96.98 | |
| d1zara2 | 191 | Rio2 serine protein kinase C-terminal domain {Arch | 96.84 |
| >d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Legume lectins domain: Legume lectin species: Furze (Ulex europaeus), UEA-II [TaxId: 3902]
Probab=99.81 E-value=1.1e-20 Score=154.10 Aligned_cols=77 Identities=30% Similarity=0.476 Sum_probs=70.7
Q ss_pred cccCCCceEEEEEEeeCCCceEEEEEEeCCCCCcccceeEEEecCCccCCceeEEEEEeecCCC--ccccceeeeeeccC
Q 047282 6 SDVKSGRRNEAWISYNSSTHNLSVAFTGFRNNSVVMQGLDYQVDLRQHLPEFVTFGFSMETGVD--FTIFSIYLWEFNSS 83 (187)
Q Consensus 6 ~~l~~G~~~~awI~Yd~~~~~L~V~ls~~~~~~p~~p~ls~~vdLs~~L~~~v~VGFSasTG~~--~~~h~i~sW~F~~~ 83 (187)
.++.+|+.++|||+||+.+++|+|+|++.. +|..|+|+..+||+++|+++||||||||||.. .|.|+|++|+|+++
T Consensus 158 ~~~~~G~~~~v~I~Yd~~~~~L~V~l~~~~--~~~~p~ls~~vDLs~~l~~~vyvGFSasTG~~~~~q~h~I~sWsF~s~ 235 (237)
T d1qnwa_ 158 WDWRNGEVADVVITYRAPTKSLTVCLSYPS--DGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSN 235 (237)
T ss_dssp CCCCTTCCEEEEEEEEGGGTEEEEEEECTT--TCCEEEEEEECCHHHHSCSEEEEEEEEEESCGGGCBCCEEEEEEEEEE
T ss_pred cccCCCcEEEEEEEEcCCCcEEEEEEecCC--CCccceEEEEEChHHhCCCcEEEEEEeECCCCCCccEeEEEEeEeEEe
Confidence 457899999999999999999999998764 68899999999999999999999999999975 48999999999987
Q ss_pred C
Q 047282 84 L 84 (187)
Q Consensus 84 ~ 84 (187)
+
T Consensus 236 l 236 (237)
T d1qnwa_ 236 L 236 (237)
T ss_dssp C
T ss_pred c
Confidence 5
|
| >d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} | Back information, alignment and structure |
|---|
| >d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} | Back information, alignment and structure |
|---|
| >d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} | Back information, alignment and structure |
|---|
| >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} | Back information, alignment and structure |
|---|
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} | Back information, alignment and structure |
|---|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|