Citrus Sinensis ID: 047293


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MSSAQDPFYIVKEEIQDSINKLQSTFHQWENSASDPGEQVHLKKELLAGCESIEWQVDELDKAIGVASRDPSWYGIDDIELEKRRRWTSTARTQVSSMKKAVLSGGANGVGTMSASGMRRELMRLPNSHQAKSNQYAAAQDNDDFIQSESDRQLLLVKQQDEELDELSASVQRIGGVGLTIHDELVAQENIIDELGTEMDSTSNRLDFVQKKVAMVMKKASAKGQIMMILFLIALFIVLFVLVFLT
cccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHcccccccccccccHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcc
**SAQDPFYIVKEEIQDSINKL*****************VHLKKELLAGCESIEWQVDELDKAIGVASRDPSWYGIDDIELEKRRRW*******************ANGVGTMSASGM*************************DFIQSESDRQLLLVKQQDEELDELSASVQRIGGVGLTIHDELVAQENIIDELGTEMDSTSNRLDFVQKKVAMVMKKASAKGQIMMILFLIALFIVLFVLVFLT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSAQDPFYIVxxxxxxxxxxxxxxxxxxxxxASDPGEQVHLKKELLAGCESIEWQVDELDKAIGVASRDPSWYGIDDIELEKRRRWTSTARTQVSSMKKAVLSGGANGVGTMSASGMRRELMRLPNSHQAKSNQYAAAQDNDDFIQSESDRQLLLVKQQDEELDELSASVQRIGGVGLTIHDELVAQENIxxxxxxxxxxxxxxxxxxxxxVAMVMKKASAKGQIMMILFLIALFIVLFVLVFLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Syntaxin-61 Vesicle trafficking protein that functions in the secretory pathway. Involved in osmotic stress tolerance and in abscisic acid (ABA) regulation of stomatal responses.confidentQ946Y7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DND, chain A
Confidence level:very confident
Coverage over the Query: 6-102
View the alignment between query and template
View the model in PyMOL
Template: 2NPS, chain D
Confidence level:confident
Coverage over the Query: 161-223
View the alignment between query and template
View the model in PyMOL
Template: 1DN1, chain B
Confidence level:confident
Coverage over the Query: 5-210
View the alignment between query and template
View the model in PyMOL