Citrus Sinensis ID: 047367


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
MFFLLLFSSFLNQASLSSIIQPVSVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTPEPYSTLPPPLNKVGRVLFHQPVLAWPAMFTTTFTVRISKFPDATGSGDGMAFVMAQDNKPPPPNGYGSYLGIMDKSTQDGVVRQLAVELDTYMNEYMIPDGNHIGVDTTSMATPVAAKSLNSTGIDLKSGRNITVKIDYDGAKTVPNAVYVGFTASTGLLQESHQLLDRVFVSFPIEFDEKGQSKVDGIRIILAIVVPILVLMIVVVNSEEEKEEDEEEDIENRARSAANVPILFSYKQLQKATHNFSKENLLGKGEREYLAEICTIGRLRHKNLVQLRGWCHEREHLLLVYEYMANGSLDLFIGKGFLDWKTRYKILTGLASALLYLHEECDKPIVHHSEYNARLGDLGLARLIQNDACVTTMMAGTPGYLAPEVSFSGKATPEFDVYSFGMVALEVACGRRSKGLFEENSLVDYVWSLYGKNALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRPKIRKVVQIFLNPNEPLMDLPHARPNAVYVSVSSASTADVGSSSVATADETRTPDDKA
cHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccEEEEEEEEcccEEEcccccccccccccccEEEEEEcccccccccccEEEEEEEEEcccccccccccEEEEEcccccccccccccccccccccccccccccEEEEEEEcccccccccccccEEEEcccccccccccccccccccccccccEEEEEEEEcccccccEEEEccccccccccccEEEEEEEccccccccccccccccccEEEEHHHHHHHHEEEEEEEEHHHHHHHHHHHHHHHHHHHcccccEEEcHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccEEEEEccccEEEEEEEccccccHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccEEEccccccccccccccEEccccccEEEEEEccccccccccccccccccccccccHHHEEEEHHcccccccccccccHHHHHHHHHccccHHHHHHHcccccccHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccccccccccccEEEcccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccEccccEEEEccccccccccccccccEEEccccccccccccEEEEEEEEEccccccccccEEEEEEEcccccccccccccEEEEEEcccccccccEEEEEEEcccccccccccccEEEEEcccEEEccccccccEEEEEcccccEEEEEEEcccccccccEEEEEEccccccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEcHHccccccccHHEEEcccccccEEEEEcHccccHHHHHccccccccHHHHHHEEEEEEEcccccccccccccHHHHHHHHHccccHHHHccHHHcccccHHHHHHHHHHccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccc
MFFLLLFSSFLNqaslssiiqpvsvpitfnnfnpdscnngndlicmgsvtagngylsltpepystlppplnkvgrvlfhqpvlawpamfTTTFTVRIskfpdatgsgdgMAFVMaqdnkppppngygsylgimdkstqDGVVRQLAVELDTYMneymipdgnhigvdttsmatPVAAKSlnstgidlksgrnitvkidydgaktvpnaVYVGFTASTGLLQESHQLLDRVFVsfpiefdekgqskvDGIRIILAIVVPILVLMIVVVnseeekeedeeEDIENRARSAANVPILFSYKQLQKATHNFskenllgkgeREYLAEICTIGRLRHKNLVQLRGWCHEREHLLLVYEYMAngsldlfigkgflDWKTRYKILTGLASALLYLHeecdkpivhhseynarlgdlGLARLIQNDACVttmmagtpgylapevsfsgkatpefdvySFGMVALEVACGrrskglfeensLVDYVWSLYGKNALLECVDKqlegefdeEQVKRTLTVGfaslhpdcmlrpKIRKVVQIFlnpneplmdlpharpnavYVSVssastadvgsssvatadetrtpddka
MFFLLLFSSFLNQASLSSIIQPVSVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTPEPYSTLPPPLNKVGRVLFHQPVLAWPAMFTTTFTVRISKFPDATGSGDGMAFVMAQDNKPPPPNGYGSYLGIMDKSTQDGVVRQLAVELDTYMNEYMIPDGNHIGVDTTSMATPVAAKSlnstgidlksgrNITVKIDYDGAKTVPNAVYVGFTASTGLLQESHQLLDRVFVSFPIEFdekgqskvdgIRIILAIVVPILVLMIVVVNseeekeedeeedIENRARSAANVPILFSYKQLQKATHNFskenllgkgeREYLAEICTIGRLRHKNLVQLRGWCHEREHLLLVYEYMANGSLDLFIGKGFLDWKTRYKILTGLASALLYLHEECDKPIVHHSEYNARLGDLGLARLIQNDACVTTMMAGTPGYLAPEVSFSGKATPEFDVYSFGMVALEVACGRRSKGLFEENSLVDYVWSLYGKNALLECVDKQLEGEFDEEQVKRTLTVGFaslhpdcmlrPKIRKVVQIFLNPNEPLMDLPHARPNAVYVSVSSastadvgsssvatadetrtpddka
MfflllfssflnqaslssIIQPVSVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTPEPYSTLPPPLNKVGRVLFHQPVLAWPAMFTTTFTVRISKFPDATGSGDGMAFVMAQDNKPPPPNGYGSYLGIMDKSTQDGVVRQLAVELDTYMNEYMIPDGNHIGVDTTSMATPVAAKSLNSTGIDLKSGRNITVKIDYDGAKTVPNAVYVGFTASTGLLQESHQLLDRVFVSFPIEFDEKGQSKVDGiriilaivvpilvlmivvvNSeeekeedeeedieNRARSAANVPILFSYKQLQKATHNFSKENLLGKGEREYLAEICTIGRLRHKNLVQLRGWCHEREHLLLVYEYMANGSLDLFIGKGFLDWKTRYKILTGLASALLYLHEECDKPIVHHSEYNARLGDLGLARLIQNDACVTTMMAGTPGYLAPEVSFSGKATPEFDVYSFGMVALEVACGRRSKGLFEENSLVDYVWSLYGKNALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRPKIRKVVQIFLNPNEPLMDLPHARPNavyvsvssastadvgsssvatadETRTPDDKA
*FFLLLFSSFLNQASLSSIIQPVSVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTPEPYSTLPPPLNKVGRVLFHQPVLAWPAMFTTTFTVRISKFPDA**********************YGSYLGIMDKSTQDGVVRQLAVELDTYMNEYMIPDGNHIGVDTTSMATPVAAKSLNSTGIDLKSGRNITVKIDYDGAKTVPNAVYVGFTASTGLLQESHQLLDRVFVSFPIEFDEKGQSKVDGIRIILAIVVPILVLMIVVVN*********************NVPILFSYKQLQKATHNFSKENLLGKGEREYLAEICTIGRLRHKNLVQLRGWCHEREHLLLVYEYMANGSLDLFIGKGFLDWKTRYKILTGLASALLYLHEECDKPIVHHSEYNARLGDLGLARLIQNDACVTTMMAGTPGYLAPEVSFSGKATPEFDVYSFGMVALEVACGRRSKGLFEENSLVDYVWSLYGKNALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRPKIRKVVQIFLNPNEPLMDLP*****AVYV****************************
MFFLLLFSSFLNQASLSSIIQPVSVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTPEPYSTLPPPLNKVGRVLFHQPVLAWPAMFTTTFTVRISKFPDATGSGDGMAFVMAQDNKPPP*NGYGSYLGIMDKSTQDGVVRQLAVELDTYMNEYMIPDGNHIGVDTTSMATPVAAKSLNSTGIDLKSGRNITVKIDYDGAKTVPNAVYVGFTASTGLLQESHQLLDRV*****************GIRIILAIVVPILVLMIVVVNSEEEKEEDEEEDIENRARSAANVPILFSYKQLQKATHNFSKENLLGKGEREYLAEICTIGRLRHKNLVQLRGWCHEREHLLLVYEYMANGSLDLFIGKGFLDWKTRYKILTGLASALLYLHEECDKPIVHHSEYNARLGDLGLARLIQNDACVTTMMAGTPGYLAPEVSFSGKATPEFDVYSFGMVALEVACGRRSKGLFEENSLVDYVWSLYGKNALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRPKIRKVVQIFLNPNEPLMDLPHARP*********************************
MFFLLLFSSFLNQASLSSIIQPVSVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTPEPYSTLPPPLNKVGRVLFHQPVLAWPAMFTTTFTVRISKFPDATGSGDGMAFVMAQDNKPPPPNGYGSYLGIMDKSTQDGVVRQLAVELDTYMNEYMIPDGNHIGVDTTSMATPVAAKSLNSTGIDLKSGRNITVKIDYDGAKTVPNAVYVGFTASTGLLQESHQLLDRVFVSFPIEFDEKGQSKVDGIRIILAIVVPILVLMIVVVNS**************RARSAANVPILFSYKQLQKATHNFSKENLLGKGEREYLAEICTIGRLRHKNLVQLRGWCHEREHLLLVYEYMANGSLDLFIGKGFLDWKTRYKILTGLASALLYLHEECDKPIVHHSEYNARLGDLGLARLIQNDACVTTMMAGTPGYLAPEVSFSGKATPEFDVYSFGMVALEVACGRRSKGLFEENSLVDYVWSLYGKNALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRPKIRKVVQIFLNPNEPLMDLPHARPNAVYVS***************************
MFFLLLFSSFLNQASLSSIIQPVSVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTPEPYSTLPPPLNKVGRVLFHQPVLAWPAMFTTTFTVRISKFPDATGSGDGMAFVMAQDNKPPPPNGYGSYLGIMDKSTQDGVVRQLAVELDTYMNEYMIPDGNHIGVDTTSMATPVAAKSLNSTGIDLKSGRNITVKIDYDGAKTVPNAVYVGFTASTGLLQESHQLLDRVFVSFPIEFDEKGQSKVDGIRIILAIVVPILVLMIVVVNSEEEKEEDEEEDIENRARSAANVPILFSYKQLQKATHNFSKENLLGKGEREYLAEICTIGRLRHKNLVQLRGWCHEREHLLLVYEYMANGSLDLFIGKGFLDWKTRYKILTGLASALLYLHEECDKPIVHHSEYNARLGDLGLARLIQNDACVTTMMAGTPGYLAPEVSFSGKATPEFDVYSFGMVALEVACGRRSKGLFEENSLVDYVWSLYGKNALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRPKIRKVVQIFLNPNEPLMDLPHARPNAVYVSVS*************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFFLLLFSSFLNQASLSSIIQPVSVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTPEPYSTLPPPLNKVGRVLFHQPVLAWPAMFTTTFTVRISKFPDATGSGDGMAFVMAQDNKPPPPNGYGSYLGIMDKSTQDGVVRQLAVELDTYMNEYMIPDGNHIGVDTTSMATPVAAKSLNSTGIDLKSGRNITVKIDYDGAKTVPNAVYVGFTASTGLLQESHQLLDRVFVSFPIEFDEKGQSKVDGIRIILAIVVPILVLMIVVVNSEEEKEEDEEEDIENRARSAANVPILFSYKQLQKATHNFSKENLLGKGEREYLAEICTIGRLRHKNLVQLRGWCHEREHLLLVYEYMANGSLDLFIGKGFLDWKTRYKILTGLASALLYLHEECDKPIVHHSEYNARLGDLGLARLIQNDACVTTMMAGTPGYLAPEVSFSGKATPEFDVYSFGMVALEVACGRRSKGLFEENSLVDYVWSLYGKNALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRPKIRKVVQIFLNPNEPLMDLPHARPNAVYVSVSSASTADVGSSSVATADETRTPDDKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query579 2.2.26 [Sep-21-2011]
Q9FHG4681 Probable L-type lectin-do yes no 0.913 0.776 0.333 2e-79
Q9FG33652 Probable L-type lectin-do no no 0.841 0.746 0.329 3e-78
Q9LXA5651 L-type lectin-domain cont no no 0.851 0.757 0.338 3e-74
Q9M2S4684 L-type lectin-domain cont no no 0.841 0.711 0.331 2e-69
Q9LSL5675 L-type lectin-domain cont no no 0.820 0.703 0.326 5e-66
O49445681 Probable L-type lectin-do no no 0.751 0.638 0.310 1e-58
Q9LFH9715 L-type lectin-domain cont no no 0.476 0.386 0.384 1e-55
O81291669 L-type lectin-domain cont no no 0.865 0.748 0.301 1e-55
Q9M9E0656 L-type lectin-domain cont no no 0.754 0.666 0.322 4e-55
O81292674 L-type lectin-domain cont no no 0.754 0.648 0.309 8e-55
>sp|Q9FHG4|LRKS7_ARATH Probable L-type lectin-domain containing receptor kinase S.7 OS=Arabidopsis thaliana GN=LECRKS7 PE=2 SV=1 Back     alignment and function desciption
 Score =  297 bits (760), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 221/662 (33%), Positives = 320/662 (48%), Gaps = 133/662 (20%)

Query: 3   FLLLFSSFLNQASLSSIIQPVSVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTPEP 62
            L++F +++   S+S   +P+ V     NF   S    N L  +G     NG + LT E 
Sbjct: 7   LLVIFFTWITALSMS---KPIFVSSDNMNFTFKSFTIRN-LTFLGDSHLRNGVVGLTRE- 61

Query: 63  YSTLPPPLNKVGRVLFHQPVLAW------PAMFTTTFTVRISKF-PDATGSGDGMAFVMA 115
              L  P    G V+++ P+  +       A F+T F+  +    PD T +GDG+AF ++
Sbjct: 62  ---LGVPDTSSGTVIYNNPIRFYDPDSNTTASFSTHFSFTVQNLNPDPTSAGDGLAFFLS 118

Query: 116 QDNKPPPPNGYGSYLGIMDKSTQDGVVRQLAVELDTYMN-EYMIPDGNHIGVDTTSMATP 174
            DN        G YLG+++ S+Q    R +A+E DT ++  +  P+GNHIG+D  S+ + 
Sbjct: 119 HDNDTL--GSPGGYLGLVN-SSQPMKNRFVAIEFDTKLDPHFNDPNGNHIGLDVDSLNSI 175

Query: 175 VAAKSLNSTGIDLKSGRNITVKIDYDGAKTVPNA-------------------------- 208
             +  L S+ IDLKSG++IT  IDY     + N                           
Sbjct: 176 STSDPLLSSQIDLKSGKSITSWIDYKNDLRLLNVFLSYTDPVTTTKKPEKPLLSVNIDLS 235

Query: 209 ------VYVGFTASTGLLQESHQLLDRVFVSF------------------------PIEF 238
                 +YVGF+ ST    E H + +  F +                         P+  
Sbjct: 236 PFLNGEMYVGFSGSTEGSTEIHLIENWSFKTSGFLPVRSKSNHLHNVSDSSVVNDDPVVI 295

Query: 239 DEKGQSKVDGIRIILAIVVPILVLMIVVV----NSEEEKEEDEEEDIENRARSAANVPIL 294
             K +     + I L I  P+L+ + + V      ++ K    E++++    +       
Sbjct: 296 PSKKRRHRHNLAIGLGISCPVLICLALFVFGYFTLKKWKSVKAEKELKTELITGLRE--- 352

Query: 295 FSYKQLQKATHNFSKENLLGKG-----------------------------EREYLAEIC 325
           FSYK+L  AT  F    ++G+G                             + E+LAE+ 
Sbjct: 353 FSYKELYTATKGFHSSRVIGRGAFGNVYRAMFVSSGTISAVKRSRHNSTEGKTEFLAELS 412

Query: 326 TIGRLRHKNLVQLRGWCHEREHLLLVYEYMANGSLDLFI------GKGFLDWKTRYKILT 379
            I  LRHKNLVQL+GWC+E+  LLLVYE+M NGSLD  +      G   LDW  R  I  
Sbjct: 413 IIACLRHKNLVQLQGWCNEKGELLLVYEFMPNGSLDKILYQESQTGAVALDWSHRLNIAI 472

Query: 380 GLASALLYLHEECDKPIVHHS----------EYNARLGDLGLARLIQNDAC-VTTMMAGT 428
           GLASAL YLH EC++ +VH             +NARLGD GLARL ++D   V+T+ AGT
Sbjct: 473 GLASALSYLHHECEQQVVHRDIKTSNIMLDINFNARLGDFGLARLTEHDKSPVSTLTAGT 532

Query: 429 PGYLAPEVSFSGKATPEFDVYSFGMVALEVACGRRSKGLFEEN----SLVDYVWSLYGKN 484
            GYLAPE    G AT + D +S+G+V LEVACGRR      E+    +LVD+VW L+ + 
Sbjct: 533 MGYLAPEYLQYGTATEKTDAFSYGVVILEVACGRRPIDKEPESQKTVNLVDWVWRLHSEG 592

Query: 485 ALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRPKIRKVVQIFLNPNEPLMDLPHA 544
            +LE VD++L+GEFDEE +K+ L VG    HPD   RP +R+V+QI  N  EP   +P  
Sbjct: 593 RVLEAVDERLKGEFDEEMMKKLLLVGLKCAHPDSNERPSMRRVLQILNNEIEP-SPVPKM 651

Query: 545 RP 546
           +P
Sbjct: 652 KP 653





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FG33|LRKS5_ARATH Probable L-type lectin-domain containing receptor kinase S.5 OS=Arabidopsis thaliana GN=LECRKS5 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXA5|LRK91_ARATH L-type lectin-domain containing receptor kinase IX.1 OS=Arabidopsis thaliana GN=LECRK91 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2S4|LRKS4_ARATH L-type lectin-domain containing receptor kinase S.4 OS=Arabidopsis thaliana GN=LECRKS4 PE=1 SV=1 Back     alignment and function description
>sp|Q9LSL5|LRK92_ARATH L-type lectin-domain containing receptor kinase IX.2 OS=Arabidopsis thaliana GN=LECRK92 PE=2 SV=1 Back     alignment and function description
>sp|O49445|LRK72_ARATH Probable L-type lectin-domain containing receptor kinase VII.2 OS=Arabidopsis thaliana GN=LECRK72 PE=1 SV=2 Back     alignment and function description
>sp|Q9LFH9|LRK81_ARATH L-type lectin-domain containing receptor kinase VIII.1 OS=Arabidopsis thaliana GN=LECRK81 PE=1 SV=1 Back     alignment and function description
>sp|O81291|LRK44_ARATH L-type lectin-domain containing receptor kinase IV.4 OS=Arabidopsis thaliana GN=LECRK44 PE=3 SV=1 Back     alignment and function description
>sp|Q9M9E0|LRKS1_ARATH L-type lectin-domain containing receptor kinase S.1 OS=Arabidopsis thaliana GN=LECRKS1 PE=1 SV=1 Back     alignment and function description
>sp|O81292|LRK43_ARATH L-type lectin-domain containing receptor kinase IV.3 OS=Arabidopsis thaliana GN=LECRK43 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query579
359476128661 PREDICTED: probable L-type lectin-domain 0.981 0.859 0.585 0.0
255548946584 conserved hypothetical protein [Ricinus 0.846 0.839 0.500 1e-145
224143120282 predicted protein [Populus trichocarpa] 0.416 0.854 0.624 3e-97
33146777 689 putative lectin-like protein kinase [Ory 0.939 0.789 0.351 7e-84
125600780 886 hypothetical protein OsJ_24802 [Oryza sa 0.858 0.560 0.365 3e-83
224095075 692 predicted protein [Populus trichocarpa] 0.936 0.783 0.350 4e-82
356566145679 PREDICTED: L-type lectin-domain containi 0.868 0.740 0.356 5e-81
356523924 700 PREDICTED: L-type lectin-domain containi 0.924 0.764 0.348 2e-80
449438248675 PREDICTED: L-type lectin-domain containi 0.808 0.693 0.364 2e-80
449438246 697 PREDICTED: L-type lectin-domain containi 0.808 0.671 0.364 4e-80
>gi|359476128|ref|XP_002282629.2| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/659 (58%), Positives = 466/659 (70%), Gaps = 91/659 (13%)

Query: 1   MFFLLLFSSFLNQASLSSIIQPVSVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTP 60
           MF LL+   FLNQA+ S + +P+S   +F++F+P +C  G+ LICMGSVTAG GYL++TP
Sbjct: 1   MFMLLVVCGFLNQAAFS-LAEPIS--FSFSSFDPGNCGTGSKLICMGSVTAGEGYLNITP 57

Query: 61  EP----YSTLPPPLNKVGRVLFHQPVLAWPAMFTTTFTVRISKFPDATGSGDGMAFVMAQ 116
           +P     ++     N VGRVL+  PV AWPA+ TTTFTVRIS FP++TGSGDGMAF+MAQ
Sbjct: 58  QPPHENETSPTSSTNMVGRVLYRHPVQAWPALITTTFTVRISPFPNSTGSGDGMAFIMAQ 117

Query: 117 DNKPPPPNGYGSYLGIMDKSTQDGVVRQLAVELDTYMNEYMIPDGNHIGVDTTSMATPVA 176
           D++P P   +GS+LGI+D+ST+ GVVRQLAVELDTYMNE+  PD NHIG+DTTS+A P+A
Sbjct: 118 DSQPSPAGSFGSFLGILDRSTEGGVVRQLAVELDTYMNEF-DPDANHIGIDTTSIAIPIA 176

Query: 177 AKSLNSTGIDLKSGRNITVKIDYDGAK--------------------------TVPNAVY 210
           AKSL+ TG+DLKSGR + VKIDYDG +                          TVP++VY
Sbjct: 177 AKSLSGTGVDLKSGREVKVKIDYDGWRETLHISVGYAGNPLLSFLNHSIALSDTVPSSVY 236

Query: 211 VGFTASTGLLQESHQLLDRVFVSFPIEFDEKGQSKVDGIRIILAIVVPILVLMIVVVNS- 269
           VGFT STG + E+HQ+LD  F S PI       S  D  + IL IV P+ V M+V+V   
Sbjct: 237 VGFTGSTGTVSETHQVLDWAFTSIPITCSSSKCSGNDKTKTILIIVFPVTVAMLVLVMCG 296

Query: 270 --------EEEKEEDEEEDIENRARSAANVPILFSYKQLQKATHNFSKENLLG------- 314
                   +      + ED E+R+RSAANVP +F+YKQL KATHNFSKENLLG       
Sbjct: 297 ILSVLRVVKRRNGRIDREDFESRSRSAANVPKMFTYKQLSKATHNFSKENLLGAGGFGTV 356

Query: 315 ----------------------KGEREYLAEICTIGRLRHKNLVQLRGWCHEREHLLLVY 352
                                 +GEREYLAEICTIGRLRHKN+VQL+GWCHE +HLLLVY
Sbjct: 357 YKGILSDHPSPIAVKKISATSKQGEREYLAEICTIGRLRHKNIVQLQGWCHEGKHLLLVY 416

Query: 353 EYMANGSLDLFIGKGFLDWKTRYKILTGLASALLYLHEECDKPIVHH----------SEY 402
           EYM+NGSLD FIG+ FLDWKTR+KILTGLASALLYLHEEC  P+VH           S+Y
Sbjct: 417 EYMSNGSLDRFIGRCFLDWKTRFKILTGLASALLYLHEECGNPVVHRDVKPNNIMLDSDY 476

Query: 403 NARLGDLGLARLIQNDACVTTMMAGTPGYLAPEVSFSGKATPEFDVYSFGMVALEVACGR 462
           NA+LGD GLARL+QNDA VTTM+AGTPGYLAPEV F+GKATP+ DVYSFGMV LEV CGR
Sbjct: 477 NAQLGDFGLARLLQNDASVTTMLAGTPGYLAPEVGFTGKATPDSDVYSFGMVVLEVVCGR 536

Query: 463 RSKGLFEENSLVDYVWSLYGKNALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRP 522
           RS+G+ EE SLVDYVW L+GK+ALL+CVD  L+GEFDEEQVKRTL VG A LHPD MLRP
Sbjct: 537 RSRGITEETSLVDYVWILHGKDALLQCVDSMLKGEFDEEQVKRTLVVGLACLHPDFMLRP 596

Query: 523 KIRKVVQIFLNPNEPLMDLPHARPNAVYVSV--SSASTADVGS-------SSVATADET 572
           ++RKV+QI LNPNEPLMDLP ARP+ ++V V  S+A+  D GS       S+   ADET
Sbjct: 597 RMRKVIQILLNPNEPLMDLPEARPSGIFVPVPSSAATVTDFGSFAASASYSNGKMADET 655




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255548946|ref|XP_002515529.1| conserved hypothetical protein [Ricinus communis] gi|223545473|gb|EEF46978.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224143120|ref|XP_002324854.1| predicted protein [Populus trichocarpa] gi|222866288|gb|EEF03419.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|33146777|dbj|BAC79695.1| putative lectin-like protein kinase [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125600780|gb|EAZ40356.1| hypothetical protein OsJ_24802 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|224095075|ref|XP_002310341.1| predicted protein [Populus trichocarpa] gi|222853244|gb|EEE90791.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356566145|ref|XP_003551295.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information
>gi|356523924|ref|XP_003530584.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Back     alignment and taxonomy information
>gi|449438248|ref|XP_004136901.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449438246|ref|XP_004136900.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query579
TAIR|locus:2162212681 AT5G55830 [Arabidopsis thalian 0.305 0.259 0.476 3.8e-65
TAIR|locus:2099941684 AT3G55550 [Arabidopsis thalian 0.257 0.217 0.5 8e-59
TAIR|locus:2142499651 AT5G10530 [Arabidopsis thalian 0.259 0.230 0.521 2.1e-54
TAIR|locus:2083986715 AT3G53380 [Arabidopsis thalian 0.253 0.205 0.5 6.2e-54
TAIR|locus:2196608656 AT1G15530 [Arabidopsis thalian 0.316 0.278 0.427 2.8e-53
TAIR|locus:2133239669 AT4G02420 [Arabidopsis thalian 0.257 0.222 0.478 3.4e-52
TAIR|locus:2133229674 LPK1 "lectin-like protein kina 0.290 0.249 0.459 1.2e-51
TAIR|locus:2144045 766 LecRK-I.9 "lectin receptor kin 0.386 0.292 0.378 1.4e-50
TAIR|locus:2170224652 AT5G06740 [Arabidopsis thalian 0.305 0.271 0.393 7.5e-50
TAIR|locus:2143528711 AT5G03140 [Arabidopsis thalian 0.260 0.212 0.463 1.8e-49
TAIR|locus:2162212 AT5G55830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 413 (150.4 bits), Expect = 3.8e-65, Sum P(4) = 3.8e-65
 Identities = 92/193 (47%), Positives = 120/193 (62%)

Query:   369 LDWKTRYKILTGLASALLYLHEECDKPIVHHS----------EYNARLGDLGLARLIQND 418
             LDW  R  I  GLASAL YLH EC++ +VH             +NARLGD GLARL ++D
Sbjct:   462 LDWSHRLNIAIGLASALSYLHHECEQQVVHRDIKTSNIMLDINFNARLGDFGLARLTEHD 521

Query:   419 AC-VTTMMAGTPGYLAPEVSFSGKATPEFDVYSFGMVALEVACGRRSKGLFEEN----SL 473
                V+T+ AGT GYLAPE    G AT + D +S+G+V LEVACGRR      E+    +L
Sbjct:   522 KSPVSTLTAGTMGYLAPEYLQYGTATEKTDAFSYGVVILEVACGRRPIDKEPESQKTVNL 581

Query:   474 VDYVWSLYGKNALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRPKIRKVVQIFLN 533
             VD+VW L+ +  +LE VD++L+GEFDEE +K+ L VG    HPD   RP +R+V+QI  N
Sbjct:   582 VDWVWRLHSEGRVLEAVDERLKGEFDEEMMKKLLLVGLKCAHPDSNERPSMRRVLQILNN 641

Query:   534 PNEPLMDLPHARP 546
               EP   +P  +P
Sbjct:   642 EIEP-SPVPKMKP 653


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000226 "microtubule cytoskeleton organization" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
TAIR|locus:2099941 AT3G55550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142499 AT5G10530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083986 AT3G53380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196608 AT1G15530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133239 AT4G02420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133229 LPK1 "lectin-like protein kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144045 LecRK-I.9 "lectin receptor kinase I.9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170224 AT5G06740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143528 AT5G03140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.110.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
cd06899236 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume 6e-46
pfam00139231 pfam00139, Lectin_legB, Legume lectin domain 3e-39
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 7e-31
pfam00069260 pfam00069, Pkinase, Protein kinase domain 6e-30
cd01951223 cd01951, lectin_L-type, legume lectins 3e-27
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-24
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-24
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 5e-24
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-23
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 7e-23
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 7e-19
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 1e-15
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 2e-15
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 2e-15
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 4e-15
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 6e-15
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 2e-14
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 8e-14
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 9e-14
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 2e-13
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 3e-13
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-12
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 3e-12
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 3e-12
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 7e-12
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 9e-12
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-11
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 3e-11
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 3e-11
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 2e-10
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 5e-10
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 8e-10
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 9e-10
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 2e-09
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-09
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 2e-09
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 4e-09
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 4e-09
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 5e-09
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 5e-09
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 7e-09
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 9e-09
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 3e-08
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 4e-08
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 7e-08
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 7e-08
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 1e-07
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 1e-07
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 1e-07
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-07
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 1e-07
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 1e-07
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 1e-07
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 2e-07
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 2e-07
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 3e-07
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 3e-07
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 4e-07
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 4e-07
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 4e-07
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 4e-07
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 4e-07
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 7e-07
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 9e-07
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 1e-06
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 1e-06
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 1e-06
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 1e-06
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 2e-06
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 2e-06
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-06
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 2e-06
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 2e-06
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-06
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 3e-06
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 3e-06
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 3e-06
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 3e-06
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 3e-06
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 4e-06
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 4e-06
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 4e-06
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 4e-06
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 5e-06
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 5e-06
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 5e-06
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 6e-06
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 7e-06
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 8e-06
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 8e-06
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 9e-06
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 9e-06
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 9e-06
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 1e-05
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 1e-05
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 1e-05
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 1e-05
cd07308218 cd07308, lectin_leg-like, legume-like lectins: ERG 1e-05
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 1e-05
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 2e-05
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 2e-05
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 2e-05
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-05
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 2e-05
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-05
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 2e-05
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 2e-05
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-05
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 3e-05
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 3e-05
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 3e-05
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 4e-05
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 4e-05
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 4e-05
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 4e-05
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 5e-05
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 6e-05
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 6e-05
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 7e-05
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 7e-05
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 8e-05
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 9e-05
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 1e-04
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 1e-04
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 1e-04
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 1e-04
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 1e-04
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 1e-04
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 1e-04
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 1e-04
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 1e-04
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 1e-04
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 2e-04
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 2e-04
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 2e-04
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 2e-04
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 2e-04
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 3e-04
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 3e-04
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 3e-04
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 4e-04
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 4e-04
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 4e-04
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 4e-04
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 5e-04
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 5e-04
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 5e-04
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 6e-04
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 6e-04
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 6e-04
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 7e-04
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 0.001
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 0.001
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 0.001
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 0.001
cd05076274 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) do 0.001
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 0.002
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 0.002
cd05077262 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) do 0.002
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 0.002
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 0.002
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 0.003
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 0.003
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 0.003
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 0.003
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 0.003
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 0.003
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 0.004
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 0.004
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 0.004
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 0.004
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 0.004
>gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
 Score =  161 bits (410), Expect = 6e-46
 Identities = 80/240 (33%), Positives = 113/240 (47%), Gaps = 55/240 (22%)

Query: 28  TFNNFNPDSCNNGNDLICMGSVT-AGNGYLSLTPEPYSTLPPPLNKVGRVLFHQPVLAW- 85
            FN F+ D     ++L   G  T + NG L LT +         + VGR L+ +PV  W 
Sbjct: 4   NFNGFSSDQ----SNLTLQGDATISSNGALQLTNDTSPA-----SSVGRALYSKPVRLWD 54

Query: 86  -----PAMFTTTFTVRISKFPDATGSGDGMAFVMAQDNKPPPPNGYGSYLGIMDKST--- 137
                 A F+T+F+  I+  P+ +  GDG+AF +A  +   PP   G YLG+ + S    
Sbjct: 55  STTGKVASFSTSFSFSIT-PPNPSLGGDGLAFFLAPTD-SLPPASSGGYLGLFNSSNNGN 112

Query: 138 -QDGVVRQLAVELDTYMN-EYMIPDGNHIGVDTTSMATPVAAKSLNSTGIDLKSGRNITV 195
             + +V   AVE DT+ N E+  PD NH+G+D  S+   V A   +  G  LKSG+ +  
Sbjct: 113 SSNHIV---AVEFDTFQNPEFGDPDDNHVGIDVNSL-VSVKAGYWDDDGGKLKSGKPMQA 168

Query: 196 KIDYDGA----------------------------KTVPNAVYVGFTASTGLLQESHQLL 227
            IDYD +                            K +P  VYVGF+ASTGLL E H +L
Sbjct: 169 WIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYIL 228


This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236

>gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173886 cd01951, lectin_L-type, legume lectins Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173892 cd07308, lectin_leg-like, legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|133207 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 579
cd06899236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
PF00139236 Lectin_legB: Legume lectin domain; InterPro: IPR00 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.98
KOG0578550 consensus p21-activated serine/threonine protein k 99.98
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.97
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.97
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.97
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.97
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.97
PHA02988283 hypothetical protein; Provisional 99.97
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.97
KOG0598357 consensus Ribosomal protein S6 kinase and related 99.97
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.97
KOG0198313 consensus MEKK and related serine/threonine protei 99.97
KOG0589 426 consensus Serine/threonine protein kinase [General 99.97
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.97
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 99.97
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.97
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.97
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.97
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.97
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.96
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.96
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.96
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.96
KOG0583370 consensus Serine/threonine protein kinase [Signal 99.96
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.96
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.96
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 99.96
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.96
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.96
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.96
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.96
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.96
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.96
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.96
KOG0584 632 consensus Serine/threonine protein kinase [General 99.96
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.96
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.96
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.96
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.96
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.96
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 99.96
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.96
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.96
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.96
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.96
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.96
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.96
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.96
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.96
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.96
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.96
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.96
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.96
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.96
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.96
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.96
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.96
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.96
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.96
PTZ00267 478 NIMA-related protein kinase; Provisional 99.96
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.96
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.96
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.96
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.96
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.96
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.96
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.96
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.96
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.96
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.96
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.96
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.96
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.96
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.96
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.96
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.96
KOG0596677 consensus Dual specificity; serine/threonine and t 99.96
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.96
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.96
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.96
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.96
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.96
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.96
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.96
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.96
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.96
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.96
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.96
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.96
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.96
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.96
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.95
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.95
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.95
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.95
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.95
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.95
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.95
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.95
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.95
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.95
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.95
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.95
PHA03212391 serine/threonine kinase US3; Provisional 99.95
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.95
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.95
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.95
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.95
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.95
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.95
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.95
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.95
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.95
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.95
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.95
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 99.95
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.95
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.95
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.95
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.95
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.95
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.95
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.95
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.95
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.95
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.95
KOG0663419 consensus Protein kinase PITSLRE and related kinas 99.95
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.95
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.95
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.95
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.95
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.95
KOG0616355 consensus cAMP-dependent protein kinase catalytic 99.95
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.95
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.95
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.95
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.95
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.95
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.95
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.95
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.95
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.95
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.95
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.95
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.95
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.95
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.95
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.95
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.95
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.95
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.95
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.95
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.95
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.95
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.95
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.95
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.95
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.95
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.95
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.95
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.95
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.95
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.95
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.95
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.95
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.95
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.95
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.95
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.95
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.95
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.95
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.95
KOG0660359 consensus Mitogen-activated protein kinase [Signal 99.95
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.95
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.95
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.95
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.95
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.95
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.95
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.95
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.95
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.95
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.95
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.95
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.95
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.95
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.95
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.95
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.95
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.95
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.95
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.95
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.95
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.95
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.95
PTZ00036440 glycogen synthase kinase; Provisional 99.95
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.95
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.95
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.95
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.95
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.95
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.95
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.95
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.95
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.95
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.95
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.95
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.95
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.95
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.95
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.95
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.95
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.95
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.95
PHA03207392 serine/threonine kinase US3; Provisional 99.95
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.95
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.95
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.95
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.95
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.95
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.95
PTZ00283 496 serine/threonine protein kinase; Provisional 99.95
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.95
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.94
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.94
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.94
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.94
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.94
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.94
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.94
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.94
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.94
PHA03211461 serine/threonine kinase US3; Provisional 99.94
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.94
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.94
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.94
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.94
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.94
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.94
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.94
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.94
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.94
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.94
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.94
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.94
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.94
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.94
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.94
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.94
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.94
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.94
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.94
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.94
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.94
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.94
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.94
PHA03209357 serine/threonine kinase US3; Provisional 99.94
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.94
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.94
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.94
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.94
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.94
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.94
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.94
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.94
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.94
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.94
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.94
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.94
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.94
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.94
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.94
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.94
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.94
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.94
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.94
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.94
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.94
KOG0605550 consensus NDR and related serine/threonine kinases 99.94
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.94
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.94
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.94
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.94
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.94
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.94
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.94
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.94
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.94
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.94
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.93
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.93
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.93
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.93
PTZ00284467 protein kinase; Provisional 99.93
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.93
PLN00009294 cyclin-dependent kinase A; Provisional 99.93
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.93
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.93
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.93
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.93
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.93
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.93
KOG0610459 consensus Putative serine/threonine protein kinase 99.93
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.93
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.93
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.93
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.93
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.93
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.93
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 99.93
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.93
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.93
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.93
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.93
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.93
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.93
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.93
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.93
KOG3653534 consensus Transforming growth factor beta/activin 99.93
PHA03210501 serine/threonine kinase US3; Provisional 99.93
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.93
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.93
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.93
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.93
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.93
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.93
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.92
KOG0586 596 consensus Serine/threonine protein kinase [General 99.92
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.92
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.92
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.92
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.92
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.92
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.92
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.92
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.92
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.92
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.92
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.92
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.92
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.92
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.92
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.92
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.92
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.92
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.92
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.92
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.92
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.92
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.92
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.92
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 99.92
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.92
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.91
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.91
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.91
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.91
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.91
PHA02882294 putative serine/threonine kinase; Provisional 99.91
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.91
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.91
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.9
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.9
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.89
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.89
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.89
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.89
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.89
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.89
KOG1027903 consensus Serine/threonine protein kinase and endo 99.88
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.88
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.88
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.88
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.88
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.87
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.87
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.86
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.86
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.86
PLN00181 793 protein SPA1-RELATED; Provisional 99.85
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.85
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.85
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.83
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.83
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.83
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.82
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.81
cd07308218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 99.81
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.81
PLN03224507 probable serine/threonine protein kinase; Provisio 99.8
KOG1290590 consensus Serine/threonine protein kinase [Signal 99.79
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.79
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.78
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.77
KOG1152772 consensus Signal transduction serine/threonine kin 99.77
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.73
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.72
KOG1167418 consensus Serine/threonine protein kinase of the C 99.68
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.63
cd06901248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 99.6
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.59
cd06902225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 99.45
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.43
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.39
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.35
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.32
PRK09188365 serine/threonine protein kinase; Provisional 99.31
KOG1266458 consensus Protein kinase [Signal transduction mech 99.25
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.21
PRK12274218 serine/threonine protein kinase; Provisional 99.17
cd06903215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 99.14
PF03388229 Lectin_leg-like: Legume-like lectin family; InterP 99.13
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.05
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.03
PRK10345210 hypothetical protein; Provisional 99.0
KOG0606 1205 consensus Microtubule-associated serine/threonine 98.98
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 98.96
KOG0590 601 consensus Checkpoint kinase and related serine/thr 98.87
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 98.85
PRK09605535 bifunctional UGMP family protein/serine/threonine 98.81
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 98.78
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 98.77
KOG1243 690 consensus Protein kinase [General function predict 98.71
cd06900255 lectin_VcfQ VcfQ bacterial pilus biogenesis protei 98.7
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 98.69
PRK14879211 serine/threonine protein kinase; Provisional 98.69
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 98.61
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.56
KOG3839351 consensus Lectin VIP36, involved in the transport 98.47
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.43
KOG3838497 consensus Mannose lectin ERGIC-53, involved in gly 98.42
smart00090237 RIO RIO-like kinase. 98.39
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 98.28
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 98.2
KOG06061205 consensus Microtubule-associated serine/threonine 98.05
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 97.9
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 97.63
KOG2137 700 consensus Protein kinase [Signal transduction mech 97.6
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 97.57
KOG0576 829 consensus Mitogen-activated protein kinase kinase 97.48
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 97.41
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 97.34
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 97.3
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 97.27
KOG1093 725 consensus Predicted protein kinase (contains TBC a 97.21
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 97.06
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 96.64
COG4248 637 Uncharacterized protein with protein kinase and he 96.55
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 96.54
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 96.3
KOG3087229 consensus Serine/threonine protein kinase [General 96.25
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 96.23
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 95.62
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 95.3
KOG1826 2724 consensus Ras GTPase activating protein RasGAP/neu 95.07
PRK09902216 hypothetical protein; Provisional 94.61
PLN02876 822 acyl-CoA dehydrogenase 90.86
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 87.31
PRK10593297 hypothetical protein; Provisional 85.28
COG0478304 RIO-like serine/threonine protein kinase fused to 84.81
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 83.12
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 81.99
KOG1235538 consensus Predicted unusual protein kinase [Genera 80.08
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information
Probab=100.00  E-value=9.6e-45  Score=358.11  Aligned_cols=198  Identities=40%  Similarity=0.711  Sum_probs=169.8

Q ss_pred             cceecCCCCCCCCCCCCCeEEecceeec-CCeeEcCCCCCCCCCCCCCceEEEEecCccccCC-----ce-eEEEEEEEE
Q 047367           25 VPITFNNFNPDSCNNGNDLICMGSVTAG-NGYLSLTPEPYSTLPPPLNKVGRVLFHQPVLAWP-----AM-FTTTFTVRI   97 (579)
Q Consensus        25 ~~f~f~~f~~~~~~~~~~l~~~g~a~~~-~~~l~LT~~~~~~~~~~~~~~Gr~~y~~pv~l~~-----~~-F~t~F~F~i   97 (579)
                      .+|+|++|...    ..+|+|+|+|.+. ++.|+||++  ..   ..+++|||+|++||+||+     ++ |+|+|+|.|
T Consensus         1 ~~f~f~~f~~~----~~~l~l~G~A~~~~~~~i~LT~~--~~---~~~~~G~v~y~~pi~l~~~~~~~~~sFst~F~F~i   71 (236)
T cd06899           1 LSFNFNGFSSD----QSNLTLQGDATISSNGALQLTND--TS---PASSVGRALYSKPVRLWDSTTGKVASFSTSFSFSI   71 (236)
T ss_pred             CceecCCCCCC----CCCEEEecceEcCCCCeEEecCC--CC---CCcceEEEEeCCCEEeecCCCCCceeEEEEEEEEE
Confidence            37999999864    3589999999998 799999987  31   257899999999999997     44 999999999


Q ss_pred             ecCCCCCCCCCceEEEEccCCCCCCCCCCCCccccccCCCCCCCCc-eeEEEeecCCC-CCCCCCCCeeeeecCCCcccc
Q 047367           98 SKFPDATGSGDGMAFVMAQDNKPPPPNGYGSYLGIMDKSTQDGVVR-QLAVELDTYMN-EYMIPDGNHIGVDTTSMATPV  175 (579)
Q Consensus        98 ~~~~~~~~~gdG~aF~l~~~~~~~~~~~~g~~lGl~~~~~~~~~~~-~~aVEfDt~~n-~~~D~~~~HvGidvns~~~s~  175 (579)
                      .+. ....+||||||||+|.+..++ +..|++|||++..+++...+ .+||||||++| +++||++||||||||++. |.
T Consensus        72 ~~~-~~~~~gdGlAF~i~~~~~~~~-~~~G~~lG~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHigIdvn~~~-S~  148 (236)
T cd06899          72 TPP-NPSLGGDGLAFFLAPTDSLPP-ASSGGYLGLFNSSNNGNSSNHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLV-SV  148 (236)
T ss_pred             EcC-CCCCCCCeEEEEEecCCCCCC-CCCcceeeeecCCCCCCcccceEEEEeecccCcccCCCCCCeEEEEcCCcc-cc
Confidence            985 456789999999999765543 78999999998877654444 45999999999 566999999999999998 77


Q ss_pred             cccccCCCCcccCCCceEEEEEEeCCC----------------------------cccccceeEEEEeccCccccccccc
Q 047367          176 AAKSLNSTGIDLKSGRNITVKIDYDGA----------------------------KTVPNAVYVGFTASTGLLQESHQLL  227 (579)
Q Consensus       176 ~~~~~~~~~~~~~~g~~~~~~I~yd~~----------------------------~~l~~~~~vGfsastg~~~~~~~i~  227 (579)
                      .+..+....+.+.+|+.++|||+||+.                            .+||++|||||||+||...|.|+|+
T Consensus       149 ~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i~  228 (236)
T cd06899         149 KAGYWDDDGGKLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYIL  228 (236)
T ss_pred             eeeccccccccccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEEE
Confidence            777776666678999999999999985                            4578999999999999999999999


Q ss_pred             cceeecc
Q 047367          228 DRVFVSF  234 (579)
Q Consensus       228 ~w~f~~~  234 (579)
                      +|+|++.
T Consensus       229 sWsF~s~  235 (236)
T cd06899         229 SWSFSSN  235 (236)
T ss_pred             EEEEEcC
Confidence            9999874



This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin

>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 2e-32
3uim_A326 Structural Basis For The Impact Of Phosphorylation 5e-31
2nry_A307 Crystal Structure Of Irak-4 Length = 307 1e-19
2nru_A307 Crystal Structure Of Irak-4 Length = 307 2e-19
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 2e-19
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 1e-17
1bjq_A253 The Dolichos Biflorus Seed Lectin In Complex With A 1e-17
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 6e-16
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 7e-16
1lul_A253 Db58, A Legume Lectin From Dolichos Biflorus Length 7e-16
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 1e-15
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 3e-15
1sfy_A239 Crystal Structure Of Recombinant Erythrina Corallod 1e-14
3ujo_A281 Galactose-Specific Seed Lectin From Dolichos Lablab 2e-14
1uzy_A242 Erythrina Crystagalli Lectin Length = 242 2e-14
1lte_A239 Structure Of A Legume Lectin With An Ordered N-Link 2e-14
1ax0_A239 Erythrina Corallodendron Lectin In Complex With N-A 4e-14
1fyu_A255 Crystal Structure Of Erythrina Corallodendron Lecti 5e-14
3n35_A242 Erythrina Corallodendron Lectin Mutant (Y106g) With 5e-14
2bqp_A234 The Structure Of The Pea Lectin-D-Glucopyranose Com 1e-13
1gz9_A239 High-Resolution Crystal Structure Of Erythrina Cris 1e-13
3usu_A256 Crystal Structure Of Butea Monosperma Seed Lectin L 3e-13
3usu_B242 Crystal Structure Of Butea Monosperma Seed Lectin L 3e-13
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-12
1fat_A252 Phytohemagglutinin-L Length = 252 3e-12
1g8w_A233 Improved Structure Of Phytohemagglutinin-L From The 4e-12
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 4e-12
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-12
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 4e-12
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-12
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 5e-12
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 5e-12
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 5e-12
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 5e-12
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 5e-12
1lgc_A181 Interaction Of A Legume Lectin With The N2 Fragment 5e-12
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 5e-12
2lal_A181 Crystal Structure Determination And Refinement At 2 6e-12
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 6e-12
1lgb_A181 Interaction Of A Legume Lectin With The N2 Fragment 7e-12
1ofs_A187 Pea Lectin-sucrose Complex Length = 187 8e-12
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 8e-12
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 9e-12
2ltn_A181 Design, Expression, And Crystallization Of Recombin 1e-11
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 1e-11
2fmd_A240 Structural Basis Of Carbohydrate Recognition By Bow 1e-11
1rin_A180 X-Ray Crystal Structure Of A Pea Lectin-Trimannosid 1e-11
1lof_C181 X-Ray Structure Of A Biantennary Octasaccharide-Lec 2e-11
1loa_A181 Three-Dimensional Structures Of Complexes Of Lathyr 2e-11
1gnz_A257 Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)m 3e-11
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 3e-11
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 4e-11
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 4e-11
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 4e-11
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 4e-11
1hql_A257 The Xenograft Antigen In Complex With The B4 Isolec 4e-11
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 5e-11
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 6e-11
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 6e-11
2sba_A253 Soybean Agglutinin Complexed With 2,6-Pentasacchari 7e-11
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 8e-11
1n47_A233 Isolectin B4 From Vicia Villosa In Complex With The 1e-10
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 1e-10
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-10
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 2e-10
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 2e-10
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 2e-10
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 2e-10
1dbn_A239 Maackia Amurensis Leukoagglutinin (Lectin) With Sia 3e-10
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 4e-10
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 4e-10
3ipv_B239 Crystal Structure Of Spatholobus Parviflorus Seed L 4e-10
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 5e-10
2b7y_A182 Fava Bean Lectin-Glucose Complex Length = 182 7e-10
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 8e-10
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 1e-09
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-09
3ipv_A251 Crystal Structure Of Spatholobus Parviflorus Seed L 2e-09
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 2e-09
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 4e-09
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 5e-09
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 6e-09
1gsl_A243 Lectin (Fourth Isolated From (Griffonia Simplicifol 7e-09
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 7e-09
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 8e-09
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 8e-09
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 9e-09
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 9e-09
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 1e-08
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 1e-08
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 1e-08
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 1e-08
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 1e-08
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 1e-08
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 2e-08
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 2e-08
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 2e-08
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 2e-08
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 2e-08
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 2e-08
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 2e-08
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 2e-08
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 3e-08
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 3e-08
2pel_A236 Peanut Lectin Length = 236 3e-08
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 3e-08
1bzw_A232 Peanut Lectin Complexed With C-Lactose Length = 232 3e-08
3zvx_A261 Structure Of The Lectin From Platypodium Elegans In 3e-08
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 3e-08
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 4e-08
1qnw_A242 Lectin Ii From Ulex Europaeus Length = 242 4e-08
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 5e-08
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 6e-08
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 6e-08
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 8e-08
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 8e-08
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 8e-08
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 1e-07
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 2e-07
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 3e-07
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 3e-07
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 3e-07
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 3e-07
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 3e-07
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 4e-07
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 6e-07
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 6e-07
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 7e-07
1fay_A238 Winged Bean Acidic Lectin Complexed With Methyl-Alp 7e-07
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 7e-07
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 7e-07
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 8e-07
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 8e-07
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 8e-07
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 8e-07
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 9e-07
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 1e-06
2pl0_A289 Lck Bound To Imatinib Length = 289 1e-06
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 1e-06
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 1e-06
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 1e-06
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 1e-06
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 1e-06
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 1e-06
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 1e-06
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 1e-06
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 1e-06
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 1e-06
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-06
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 1e-06
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 1e-06
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 1e-06
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 2e-06
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 2e-06
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 2e-06
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 2e-06
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 2e-06
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 2e-06
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 2e-06
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 2e-06
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 2e-06
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 2e-06
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 2e-06
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 2e-06
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 2e-06
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 2e-06
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 2e-06
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 2e-06
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-06
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 2e-06
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 2e-06
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 2e-06
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 2e-06
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 2e-06
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 2e-06
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 2e-06
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 2e-06
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 2e-06
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 2e-06
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 2e-06
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 2e-06
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 2e-06
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 2e-06
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 2e-06
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 2e-06
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 2e-06
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 2e-06
1fny_A237 Legume Lectin Of The Bark Of Robinia Pseudoacacia. 2e-06
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 2e-06
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 2e-06
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 3e-06
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 3e-06
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-06
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 3e-06
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 3e-06
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 3e-06
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 3e-06
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 3e-06
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 3e-06
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 3e-06
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-06
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 3e-06
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 3e-06
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 3e-06
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-06
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 3e-06
1wbl_A241 Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga 3e-06
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-06
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-06
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 3e-06
1wbf_A242 Winged Bean Lectin, Saccharide Free Form Length = 2 3e-06
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 3e-06
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 3e-06
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 3e-06
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 3e-06
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-06
3g2f_A336 Crystal Structure Of The Kinase Domain Of Bone Morp 4e-06
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 4e-06
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 4e-06
2e7q_A237 Crystal Structure Of Basic Winged Bean Lectin In Co 4e-06
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 4e-06
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 4e-06
4fie_A423 Full-Length Human Pak4 Length = 423 4e-06
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 4e-06
2eig_A234 Lotus Tetragonolobus Seed Lectin (Isoform) Length = 5e-06
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 5e-06
3a7f_A303 Human Mst3 Kinase Length = 303 5e-06
3a4o_X286 Lyn Kinase Domain Length = 286 5e-06
3q4t_A322 Crystal Structure Of Activin Receptor Type-Iia (Acv 5e-06
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 5e-06
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 6e-06
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 6e-06
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 6e-06
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 6e-06
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 6e-06
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 6e-06
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 6e-06
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 6e-06
3mdy_A337 Crystal Structure Of The Cytoplasmic Domain Of The 7e-06
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 7e-06
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 7e-06
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 7e-06
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 7e-06
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 8e-06
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 8e-06
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 8e-06
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 8e-06
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 8e-06
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 8e-06
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 8e-06
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 9e-06
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 9e-06
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 9e-06
1q8o_A252 Pterocartpus Angolensis Lectin Pal In Complex With 9e-06
1n3o_A252 Pterocarcpus Angolensis Lectin In Complex With Alph 9e-06
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 1e-05
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 1e-05
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-05
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 1e-05
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 1e-05
1fx5_A242 Crystal Structure Analysis Of Ulex Europaeus Lectin 2e-05
2yz4_A237 The Neutron Structure Of Concanavalin A At 2.2 Angs 2e-05
2ctv_A237 High Resolution Crystallographic Studies Of Native 2e-05
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-05
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 2e-05
2ovu_A237 Crystal Strucure Of A Lectin From Canavalia Gladiat 2e-05
2ovu_A237 Crystal Strucure Of A Lectin From Canavalia Gladiat 2e-05
2zbj_A237 Crystal Structure Of Dioclea Rostrata Lectin Length 2e-05
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 2e-05
1wuv_A237 Crystal Structure Of Native Canavalia Gladiata Lect 2e-05
1wuv_A237 Crystal Structure Of Native Canavalia Gladiata Lect 8e-05
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 2e-05
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 3e-05
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 3e-05
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 3e-05
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 3e-05
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 3e-05
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 3e-05
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 3e-05
1azd_A237 Concanavalin From Canavalia Brasiliensis Length = 2 3e-05
1azd_A237 Concanavalin From Canavalia Brasiliensis Length = 2 1e-04
3u4x_A236 Crystal Structure Of A Lectin From Camptosema Pedic 3e-05
3u4x_A236 Crystal Structure Of A Lectin From Camptosema Pedic 8e-04
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 3e-05
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 3e-05
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 3e-05
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 4e-05
2jec_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 4e-05
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 4e-05
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 4e-05
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 4e-05
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 4e-05
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 4e-05
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 4e-05
1avb_A226 Arcelin-1 From Phaseolus Vulgaris L Length = 226 4e-05
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 4e-05
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 5e-05
1b6c_B342 Crystal Structure Of The Cytoplasmic Domain Of The 5e-05
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 5e-05
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 5e-05
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 5e-05
2d3p_A236 Cratylia Floribunda Seed Lectin Crystallized At Bas 5e-05
2d3p_A236 Cratylia Floribunda Seed Lectin Crystallized At Bas 4e-04
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 5e-05
1py5_A326 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 6e-05
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 6e-05
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-05
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 7e-05
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-05
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 7e-05
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 7e-05
1vjy_A303 Crystal Structure Of A Naphthyridine Inhibitor Of H 7e-05
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 7e-05
1rw8_A301 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 7e-05
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 7e-05
3kk9_A282 Camkii Substrate Complex B Length = 282 7e-05
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 7e-05
3h9r_A330 Crystal Structure Of The Kinase Domain Of Type I Ac 7e-05
4dym_A301 Crystal Structure Of The Acvr1 Kinase Domain In Com 7e-05
3mtf_A301 Crystal Structure Of The Acvr1 Kinase In Complex Wi 7e-05
3kk8_A284 Camkii Substrate Complex A Length = 284 7e-05
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 7e-05
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 8e-05
2wot_A306 Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl) 8e-05
3tzm_A309 Tgf-Beta Receptor Type 1 In Complex With Sb431542 L 8e-05
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 8e-05
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 8e-05
2ow4_A237 Crystal Structure Of A Lectin From Canavalia Mariti 9e-05
2ow4_A237 Crystal Structure Of A Lectin From Canavalia Mariti 1e-04
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 9e-05
2cna_A237 The Covalent And Three-Dimensional Structure Of Con 9e-05
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 1e-04
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 1e-04
1h9w_A237 Native Dioclea Guianensis Seed Lectin Length = 237 1e-04
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 1e-04
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 1e-04
1cn1_A237 Crystal Structure Of Demetallized Concanavalin A. T 1e-04
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 1e-04
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-04
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 1e-04
2cwm_A237 Native Crystal Structure Of No Releasing Inductive 1e-04
2cwm_A237 Native Crystal Structure Of No Releasing Inductive 1e-04
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 1e-04
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 1e-04
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 1e-04
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 1e-04
2qlu_A314 Crystal Structure Of Activin Receptor Type Ii Kinas 1e-04
2gdf_A237 Crystal Structure Of Dioclea Violacea Seed Lectin L 1e-04
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 1e-04
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 1e-04
2je9_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 1e-04
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 1e-04
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 1e-04
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 1e-04
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 1e-04
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 1e-04
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 1e-04
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 1e-04
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 1e-04
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 1e-04
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 2e-04
3g51_A325 Structural Diversity Of The Active Conformation Of 2e-04
3soa_A 444 Full-Length Human Camkii Length = 444 2e-04
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 2e-04
1dgl_A237 Lectin From Dioclea Grandiflora Complexed To Triman 2e-04
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 2e-04
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 2e-04
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 2e-04
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 2e-04
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 2e-04
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 2e-04
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 2e-04
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 2e-04
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 2e-04
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 2e-04
3rrd_A237 Native Structure Of Dioclea Virgata Lectin Length = 2e-04
1mvq_A236 Cratylia Mollis Lectin (Isoform 1) In Complex With 2e-04
1mvq_A236 Cratylia Mollis Lectin (Isoform 1) In Complex With 5e-04
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 2e-04
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 3e-04
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 3e-04
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-04
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 3e-04
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 3e-04
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 3e-04
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 3e-04
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 3e-04
3sh3_A237 Crystal Structure Of A Pro-Inflammatory Lectin From 4e-04
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 4e-04
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 4e-04
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 4e-04
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 4e-04
3my0_A305 Crystal Structure Of The Acvrl1 (Alk1) Kinase Domai 4e-04
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 4e-04
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 4e-04
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 4e-04
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 4e-04
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 4e-04
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 5e-04
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 5e-04
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-04
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 5e-04
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 5e-04
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-04
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 5e-04
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 5e-04
1h9p_A237 Crystal Structure Of Dioclea Guianensis Seed Lectin 5e-04
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 5e-04
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 6e-04
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 6e-04
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 6e-04
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 6e-04
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 6e-04
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 6e-04
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 6e-04
3b2t_A311 Structure Of Phosphotransferase Length = 311 6e-04
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 6e-04
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 6e-04
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 6e-04
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 6e-04
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 6e-04
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 7e-04
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 7e-04
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 7e-04
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 7e-04
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 7e-04
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 7e-04
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 7e-04
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 8e-04
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 8e-04
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 8e-04
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-04
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 9e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 137 bits (344), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 91/287 (31%), Positives = 144/287 (50%), Gaps = 50/287 (17%) Query: 295 FSYKQLQKATHNFSKENLLGKG-----------------------------EREYLAEIC 325 FS ++LQ A+ NFS +N+LG+G E ++ E+ Sbjct: 28 FSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERXQGGELQFQTEVE 87 Query: 326 TIGRLRHKNLVQLRGWCHEREHLLLVYEYMANGSLDLFI-----GKGFLDWKTRYKILTG 380 I H+NL++LRG+C LLVY YMANGS+ + + LDW R +I G Sbjct: 88 MISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQRIALG 147 Query: 381 LASALLYLHEECDKPIVHH----------SEYNARLGDLGLARLIQ-NDACVTTMMAGTP 429 A L YLH+ CD I+H E+ A +GD GLA+L+ D V + GT Sbjct: 148 SARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDXHVXXAVRGTI 207 Query: 430 GYLAPEVSFSGKATPEFDVYSFGMVALEVACGRRSKGLF-----EENSLVDYVWSLYGKN 484 G++APE +GK++ + DV+ +G++ LE+ G+R+ L ++ L+D+V L + Sbjct: 208 GHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEK 267 Query: 485 ALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRPKIRKVVQIF 531 L VD L+G + +E+V++ + V M RPK+ +VV++ Sbjct: 268 KLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRML 314
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|1SFY|A Chain A, Crystal Structure Of Recombinant Erythrina Corallodandron Lectin Length = 239 Back     alignment and structure
>pdb|3UJO|A Chain A, Galactose-Specific Seed Lectin From Dolichos Lablab In Complex With Adenine And Galactose Length = 281 Back     alignment and structure
>pdb|1UZY|A Chain A, Erythrina Crystagalli Lectin Length = 242 Back     alignment and structure
>pdb|1LTE|A Chain A, Structure Of A Legume Lectin With An Ordered N-Linked Carbohydrate In Complex With Lactose Length = 239 Back     alignment and structure
>pdb|1AX0|A Chain A, Erythrina Corallodendron Lectin In Complex With N-Actylgalactosamine Length = 239 Back     alignment and structure
>pdb|1FYU|A Chain A, Crystal Structure Of Erythrina Corallodendron Lectin In Hexagonal Crystal Form Length = 255 Back     alignment and structure
>pdb|3N35|A Chain A, Erythrina Corallodendron Lectin Mutant (Y106g) With N- Acetylgalactosamine Length = 242 Back     alignment and structure
>pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 Back     alignment and structure
>pdb|1GZ9|A Chain A, High-Resolution Crystal Structure Of Erythrina Cristagalli Lectin In Complex With 2'-Alpha-L-Fucosyllactose Length = 239 Back     alignment and structure
>pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 Back     alignment and structure
>pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 Back     alignment and structure
>pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|1LGC|A Chain A, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 181 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|2LAL|A Chain A, Crystal Structure Determination And Refinement At 2.3 Angstroms Resolution Of The Lentil Lectin Length = 181 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|1LGB|A Chain A, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 181 Back     alignment and structure
>pdb|1OFS|A Chain A, Pea Lectin-sucrose Complex Length = 187 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|2LTN|A Chain A, Design, Expression, And Crystallization Of Recombinant Lectin From The Garden Pea (Pisum Sativum) Length = 181 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 Back     alignment and structure
>pdb|1RIN|A Chain A, X-Ray Crystal Structure Of A Pea Lectin-Trimannoside Complex At 2.6 Angstroms Resolution Length = 180 Back     alignment and structure
>pdb|1LOF|C Chain C, X-Ray Structure Of A Biantennary Octasaccharide-Lectin Complex At 2.3 Angstroms Resolution Length = 181 Back     alignment and structure
>pdb|1LOA|A Chain A, Three-Dimensional Structures Of Complexes Of Lathyrus Ochrus Isolectin I With Glucose And Mannose: Fine Specificity Of The Monosaccharide-Binding Site Length = 181 Back     alignment and structure
>pdb|1GNZ|A Chain A, Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)metal Free Form Length = 257 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|1HQL|A Chain A, The Xenograft Antigen In Complex With The B4 Isolectin Of Griffonia Simplicifolia Lectin-1 Length = 257 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|1DBN|A Chain A, Maackia Amurensis Leukoagglutinin (Lectin) With Sialyllactose Length = 239 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|3IPV|B Chain B, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 239 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|2B7Y|A Chain A, Fava Bean Lectin-Glucose Complex Length = 182 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3IPV|A Chain A, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 251 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|1GSL|A Chain A, Lectin (Fourth Isolated From (Griffonia Simplicifolia)) Complex With Y Human Blood Group Determinant Length = 243 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|2PEL|A Chain A, Peanut Lectin Length = 236 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|1BZW|A Chain A, Peanut Lectin Complexed With C-Lactose Length = 232 Back     alignment and structure
>pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|1FAY|A Chain A, Winged Bean Acidic Lectin Complexed With Methyl-Alpha-D-Galactose (Monoclinic Form) Length = 238 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|1FNY|A Chain A, Legume Lectin Of The Bark Of Robinia Pseudoacacia. Length = 237 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|3G2F|A Chain A, Crystal Structure Of The Kinase Domain Of Bone Morphogenetic Protein Receptor Type Ii (Bmpr2) At 2.35 A Resolution Length = 336 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2E7Q|A Chain A, Crystal Structure Of Basic Winged Bean Lectin In Complex With B Blood Group Trisaccharide Length = 237 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|2EIG|A Chain A, Lotus Tetragonolobus Seed Lectin (Isoform) Length = 234 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3Q4T|A Chain A, Crystal Structure Of Activin Receptor Type-Iia (Acvr2a) Kinase Domain In Complex With Dorsomorphin Length = 322 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3MDY|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of The Bone Morp Protein Receptor Type-1b (Bmpr1b) In Complex With Fkbp12 An 193189 Length = 337 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 Back     alignment and structure
>pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|1FX5|A Chain A, Crystal Structure Analysis Of Ulex Europaeus Lectin I Length = 242 Back     alignment and structure
>pdb|2YZ4|A Chain A, The Neutron Structure Of Concanavalin A At 2.2 Angstroms Length = 237 Back     alignment and structure
>pdb|2CTV|A Chain A, High Resolution Crystallographic Studies Of Native Concanavalin A Using Rapid Laue Data Collection Methods And The Introduction Of A Monochromatic Large-Angle Oscillation Technique (Lot) Length = 237 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2OVU|A Chain A, Crystal Strucure Of A Lectin From Canavalia Gladiata (Cgl) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|2OVU|A Chain A, Crystal Strucure Of A Lectin From Canavalia Gladiata (Cgl) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|1WUV|A Chain A, Crystal Structure Of Native Canavalia Gladiata Lectin (Cgl): A Tetrameric Cona-Like Lectin Length = 237 Back     alignment and structure
>pdb|1WUV|A Chain A, Crystal Structure Of Native Canavalia Gladiata Lectin (Cgl): A Tetrameric Cona-Like Lectin Length = 237 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|1AZD|A Chain A, Concanavalin From Canavalia Brasiliensis Length = 237 Back     alignment and structure
>pdb|1AZD|A Chain A, Concanavalin From Canavalia Brasiliensis Length = 237 Back     alignment and structure
>pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 Back     alignment and structure
>pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|1AVB|A Chain A, Arcelin-1 From Phaseolus Vulgaris L Length = 226 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|1B6C|B Chain B, Crystal Structure Of The Cytoplasmic Domain Of The Type I Tgf-Beta Receptor In Complex With Fkbp12 Length = 342 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 Back     alignment and structure
>pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|1PY5|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Inhibitor Length = 326 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|1VJY|A Chain A, Crystal Structure Of A Naphthyridine Inhibitor Of Human Tgf- Beta Type I Receptor Length = 303 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|1RW8|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Atp Site Inhibitor Length = 301 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|3H9R|A Chain A, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 330 Back     alignment and structure
>pdb|4DYM|A Chain A, Crystal Structure Of The Acvr1 Kinase Domain In Complex With The Imidazo[1,2-B]pyridazine Inhibitor K00135 Length = 301 Back     alignment and structure
>pdb|3MTF|A Chain A, Crystal Structure Of The Acvr1 Kinase In Complex With A 2- Aminopyridine Inhibitor Length = 301 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2WOT|A Chain A, Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl)-3- Pyridyl)oxy)-N-(3,4,5-Trimethoxyphenyl)pyridin-2-Amine Length = 306 Back     alignment and structure
>pdb|3TZM|A Chain A, Tgf-Beta Receptor Type 1 In Complex With Sb431542 Length = 309 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|2OW4|A Chain A, Crystal Structure Of A Lectin From Canavalia Maritima Seeds (Conm) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|2OW4|A Chain A, Crystal Structure Of A Lectin From Canavalia Maritima Seeds (Conm) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|2CNA|A Chain A, The Covalent And Three-Dimensional Structure Of Concanavalin A, Iv.Atomic Coordinates,Hydrogen Bonding,And Quaternary Structure Length = 237 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|1CN1|A Chain A, Crystal Structure Of Demetallized Concanavalin A. The Metal- Binding Region Length = 237 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|2CWM|A Chain A, Native Crystal Structure Of No Releasing Inductive Lectin From Seeds Of The Canavalia Maritima (Conm) Length = 237 Back     alignment and structure
>pdb|2CWM|A Chain A, Native Crystal Structure Of No Releasing Inductive Lectin From Seeds Of The Canavalia Maritima (Conm) Length = 237 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2QLU|A Chain A, Crystal Structure Of Activin Receptor Type Ii Kinase Domain From Human Length = 314 Back     alignment and structure
>pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 Back     alignment and structure
>pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 Back     alignment and structure
>pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3MY0|A Chain A, Crystal Structure Of The Acvrl1 (Alk1) Kinase Domain Bound To Ldn- 193189 Length = 305 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query579
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 8e-88
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-76
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 6e-74
3soc_A322 Activin receptor type-2A; structural genomics cons 8e-42
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-33
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-32
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 8e-31
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 8e-31
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-30
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 1e-30
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 2e-30
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 2e-30
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 2e-29
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 3e-29
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 4e-29
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 5e-29
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 6e-29
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 7e-29
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 7e-29
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 7e-29
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 8e-29
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 1e-28
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 1e-28
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 2e-28
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 3e-28
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 5e-28
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 7e-28
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 7e-28
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 1e-27
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 1e-27
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 1e-27
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-27
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 9e-27
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 1e-26
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 1e-26
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-26
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 5e-25
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 6e-25
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 9e-25
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 4e-24
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 9e-23
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-20
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 4e-19
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 1e-18
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 2e-18
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-18
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 4e-18
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-18
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 8e-18
1qmo_A113 Mannose binding lectin, FRIL; crosslink, hematopoi 9e-18
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 1e-17
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 1e-17
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-17
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 3e-17
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 3e-17
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 4e-17
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 4e-17
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 4e-17
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 5e-17
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 6e-17
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 7e-17
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 7e-17
3lzb_A327 Epidermal growth factor receptor; epidermal growth 2e-16
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-16
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 3e-16
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 4e-16
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 4e-16
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 4e-16
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 5e-16
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 6e-16
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 6e-16
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 7e-16
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 7e-16
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 9e-16
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 9e-16
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-15
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 2e-15
3poz_A327 Epidermal growth factor receptor; kinase domain, a 2e-15
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 2e-15
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-15
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-15
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-15
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 2e-15
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 3e-15
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 3e-15
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-15
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 3e-15
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 3e-15
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 9e-15
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-14
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-14
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-14
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 1e-14
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 1e-14
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-14
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-14
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 2e-14
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-14
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 2e-14
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 3e-14
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 4e-14
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 4e-14
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 4e-14
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 4e-14
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 5e-14
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 6e-14
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 6e-14
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 7e-14
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 8e-14
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 8e-14
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 9e-14
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 2e-13
3bhy_A283 Death-associated protein kinase 3; death associate 2e-13
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 2e-13
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 2e-13
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 2e-13
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 2e-13
4aoj_A329 High affinity nerve growth factor receptor; transf 3e-13
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 3e-13
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 3e-13
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 3e-13
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 3e-13
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 4e-13
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 4e-13
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 4e-13
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 4e-13
3pls_A298 Macrophage-stimulating protein receptor; protein k 5e-13
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 6e-13
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 8e-13
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 2e-11
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 9e-13
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 9e-13
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-12
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 2e-12
2y0a_A326 Death-associated protein kinase 1; transferase, ca 2e-12
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 2e-12
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 5e-12
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 5e-12
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 6e-12
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 6e-12
3dls_A335 PAS domain-containing serine/threonine-protein KI; 8e-12
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 8e-12
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-11
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-11
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 2e-11
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 3e-11
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 3e-11
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 3e-11
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 4e-11
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 5e-11
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 5e-11
3eqc_A360 Dual specificity mitogen-activated protein kinase; 7e-11
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 7e-11
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 7e-11
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 7e-11
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 8e-11
2eue_A275 Carbon catabolite derepressing protein kinase; kin 9e-11
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 9e-11
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 1e-10
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 1e-10
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 1e-10
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 1e-10
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-10
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-10
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-10
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 2e-10
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-10
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-10
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 2e-10
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 3e-10
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 3e-10
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 3e-10
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 4e-10
3ork_A311 Serine/threonine protein kinase; structural genomi 5e-10
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 6e-10
2xir_A316 Vascular endothelial growth factor receptor 2; ang 6e-10
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 6e-10
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 7e-10
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 7e-10
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 8e-10
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 9e-10
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 9e-10
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 1e-09
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 2e-09
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-09
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 2e-09
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 2e-09
3aln_A327 Dual specificity mitogen-activated protein kinase; 3e-09
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 4e-09
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 5e-09
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 1e-08
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 1e-08
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 1e-08
2dyl_A318 Dual specificity mitogen-activated protein kinase 1e-08
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 3e-08
3fme_A290 Dual specificity mitogen-activated protein kinase; 4e-08
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 4e-08
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 4e-08
3an0_A340 Dual specificity mitogen-activated protein kinase; 8e-08
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 4e-07
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 4e-07
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 5e-07
3o0g_A292 Cell division protein kinase 5; kinase activator c 5e-07
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 9e-07
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 1e-06
3niz_A311 Rhodanese family protein; structural genomics, str 1e-06
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 1e-06
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 1e-06
3uqc_A286 Probable conserved transmembrane protein; structur 1e-06
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 2e-06
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 2e-06
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 3e-06
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 3e-06
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 3e-06
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 4e-06
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 5e-06
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 6e-06
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 7e-06
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 8e-06
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 2e-05
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 2e-05
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 2e-05
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 3e-05
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 4e-05
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 4e-05
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 5e-05
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 7e-05
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 1e-04
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 2e-04
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-04
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-04
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 3e-04
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 4e-04
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 6e-04
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 6e-04
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 7e-04
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
 Score =  274 bits (702), Expect = 8e-88
 Identities = 96/306 (31%), Positives = 150/306 (49%), Gaps = 58/306 (18%)

Query: 274 EEDEEEDIENRARSAANVPILFSYKQLQKATHNFSKENLLGKG----------------- 316
           EED E  +             FS ++LQ A+ NFS +N+LG+G                 
Sbjct: 7   EEDPEVHLGQ--------LKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVA 58

Query: 317 ------------EREYLAEICTIGRLRHKNLVQLRGWCHEREHLLLVYEYMANGSLD--L 362
                       E ++  E+  I    H+NL++LRG+C      LLVY YMANGS+   L
Sbjct: 59  VKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCL 118

Query: 363 F---IGKGFLDWKTRYKILTGLASALLYLHEECDKPIVH----------HSEYNARLGDL 409
                 +  LDW  R +I  G A  L YLH+ CD  I+H            E+ A +GD 
Sbjct: 119 RERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDF 178

Query: 410 GLARLIQNDAC-VTTMMAGTPGYLAPEVSFSGKATPEFDVYSFGMVALEVACGRR----S 464
           GLA+L+      VTT + GT G++APE   +GK++ + DV+ +G++ LE+  G+R    +
Sbjct: 179 GLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLA 238

Query: 465 KGLFEENS-LVDYVWSLYGKNALLECVDKQLEGEFDEEQVKRTLTVGFASLHPDCMLRPK 523
           +   +++  L+D+V  L  +  L   VD  L+G + +E+V++ + V         M RPK
Sbjct: 239 RLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPK 298

Query: 524 IRKVVQ 529
           + +VV+
Sbjct: 299 MSEVVR 304


>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Length = 181 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 113 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Length = 253 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Length = 226 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Length = 222 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Length = 256 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query579
3ujo_A281 Legume lectin; carbohydrate-binding, galactose, ad 100.0
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 100.0
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 100.0
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 100.0
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 100.0
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 100.0
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 100.0
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 100.0
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 100.0
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 100.0
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 100.0
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 100.0
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 100.0
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 100.0
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 100.0
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 100.0
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 100.0
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 100.0
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 100.0
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 100.0
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 100.0
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 100.0
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 100.0
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.98
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.98
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.98
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.97
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.97
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.97
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.97
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.97
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 99.97
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.97
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.97
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.97
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.97
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.97
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.97
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.97
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.97
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.97
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.97
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.97
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.97
3q4u_A301 Activin receptor type-1; structural genomics conso 99.97
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.97
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.97
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.97
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.97
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.97
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.97
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.97
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.97
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.97
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.97
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.97
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.97
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.97
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.97
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.97
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.97
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.97
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.97
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.97
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.97
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.97
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.97
3niz_A311 Rhodanese family protein; structural genomics, str 99.97
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.97
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.97
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.97
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.97
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.97
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.97
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.97
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.97
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.97
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.97
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.97
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.97
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.97
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.97
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.97
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.97
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.97
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.97
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.97
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.97
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.97
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.97
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.97
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.97
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.97
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.97
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.97
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.97
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.97
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.97
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.97
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.97
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.97
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.97
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.97
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.97
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.97
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.97
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.97
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.97
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.97
3ork_A311 Serine/threonine protein kinase; structural genomi 99.97
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.97
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.97
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.97
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.97
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.97
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.97
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.97
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.97
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.97
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.97
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.96
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.96
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.96
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.96
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.96
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.96
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.96
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.96
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.96
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.96
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.96
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.96
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.96
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.96
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.96
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.96
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.96
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.96
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.96
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.96
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.96
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.96
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.96
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.96
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.96
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.96
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.96
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.96
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.96
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.96
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.96
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.96
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.96
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.96
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.96
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.96
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.96
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.96
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.96
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.96
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.96
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.96
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.96
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.96
3bhy_A283 Death-associated protein kinase 3; death associate 99.96
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.96
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.96
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.96
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.96
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.96
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.96
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.96
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.96
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.96
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.96
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.96
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.96
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.96
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.96
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.96
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.96
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.96
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.96
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.96
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.96
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.96
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.96
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.96
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.96
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.96
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.96
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.96
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.96
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.96
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.96
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.96
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.96
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.96
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.96
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.96
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.96
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.96
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.96
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.96
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.96
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.96
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.96
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.96
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.96
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.96
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.96
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.96
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.95
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.95
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.95
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.95
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.95
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.95
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.95
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.95
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.95
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.95
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.95
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.95
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.95
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.95
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.95
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.95
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.95
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.95
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.95
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.95
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.95
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.95
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.95
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.95
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.95
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.95
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.95
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.95
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.95
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 99.94
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.94
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.94
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.93
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.93
1qmo_A113 Mannose binding lectin, FRIL; crosslink, hematopoi 99.93
3uqc_A286 Probable conserved transmembrane protein; structur 99.92
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.92
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.91
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 99.9
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.89
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 99.88
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 99.87
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.86
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.7
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 99.58
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.19
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 99.09
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 98.84
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 98.62
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 97.42
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 97.18
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 96.76
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 96.55
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 96.43
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 93.25
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 90.74
3r70_A320 Aminoglycoside phosphotransferase; structural geno 88.03
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 87.29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 82.11
3ats_A357 Putative uncharacterized protein; hypothetical pro 81.59
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 80.38
>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-53  Score=422.32  Aligned_cols=212  Identities=32%  Similarity=0.563  Sum_probs=168.1

Q ss_pred             ChhHHHHHHHhhhhccccccCCCccceecCCCCCCCCCCCCCeEEecceeecCCeeEcCCCCCCC-CCCCCCceEEEEec
Q 047367            1 MFFLLLFSSFLNQASLSSIIQPVSVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTPEPYST-LPPPLNKVGRVLFH   79 (579)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~f~f~~f~~~~~~~~~~l~~~g~a~~~~~~l~LT~~~~~~-~~~~~~~~Gr~~y~   79 (579)
                      |+.+++||++++++.++     ...+|+|++|+.      .+|+|+|||++.+|.|+||+.  .. ..+..+++|||+|+
T Consensus         8 ~~~~~~fl~l~~~~~sa-----~~~sF~f~~F~~------~nL~l~GdA~i~~g~L~LT~~--~~~~~p~~~s~Gra~Y~   74 (281)
T 3ujo_A            8 MKRIVLFLILLTKAASA-----NLISFTFKKFNE------TNLILQRDATVSSGKLRITKA--AENGVPTAGSLGRAFYS   74 (281)
T ss_dssp             ----------------C-----EEEEEEESSCCS------TTEEECSSCCCBTTBEECSCC--CSSCCCCSSCEEEEEES
T ss_pred             HHHHHHHHHHHcccCcC-----CcceEEcCCCCc------cCEEEecceEEeCCEEEeCCC--CCCCcccCCceEEEEEC
Confidence            34555677777777655     467999999973      489999999999999999997  42 22345699999999


Q ss_pred             CccccCC-----ce-eEEEEEEEEecCCCCCCCCCceEEEEccCCCCCCCCCCCCccccccCCCCCCCCce-eEEEeecC
Q 047367           80 QPVLAWP-----AM-FTTTFTVRISKFPDATGSGDGMAFVMAQDNKPPPPNGYGSYLGIMDKSTQDGVVRQ-LAVELDTY  152 (579)
Q Consensus        80 ~pv~l~~-----~~-F~t~F~F~i~~~~~~~~~gdG~aF~l~~~~~~~~~~~~g~~lGl~~~~~~~~~~~~-~aVEfDt~  152 (579)
                      +||+|||     ++ |+|+|+|.|.+. +...+||||||||+|.++. | ++.||||||+|.+++ +..++ |||||||+
T Consensus        75 ~Pi~l~d~~tg~vaSFsTsFsF~I~~~-~~~~~gdGlAF~laP~~~~-p-~~~gg~LGL~n~~~~-~~~n~~vAVEFDT~  150 (281)
T 3ujo_A           75 TPIQIWDNTTGTVASWATSFTFNLQAP-NAASPADGLAFALVPVGSQ-P-KDKGGFLGLFDSKNY-ASSNQTVAVEFDTF  150 (281)
T ss_dssp             SCEECBCSSSCCBEEEEEEEEEECCCS-STTSCCEEEEEEEEETTCC-C-CCCGGGTTTCSCSSC-CTTSCCEEEEECCS
T ss_pred             CCEEcccCCCCCceeEEEEEEEEEecC-CCCCCCCceEEEEecCCCC-C-CCCcceeeeccccCC-CccCcEEEEEEecc
Confidence            9999998     55 999999999985 6677999999999998654 3 468999999998776 44455 59999999


Q ss_pred             CC-CCCCCCCCeeeeecCCCcccccccccCCCCcccCCCceEEEEEEeCCC--------------------------ccc
Q 047367          153 MN-EYMIPDGNHIGVDTTSMATPVAAKSLNSTGIDLKSGRNITVKIDYDGA--------------------------KTV  205 (579)
Q Consensus       153 ~n-~~~D~~~~HvGidvns~~~s~~~~~~~~~~~~~~~g~~~~~~I~yd~~--------------------------~~l  205 (579)
                      +| +| ||++|||||||||++ |..+..+     ++.+|+.++|||+||+.                          .+|
T Consensus       151 ~N~e~-Dp~~nHVGIDvNSi~-S~~t~~~-----~l~~G~~~~vwI~Yd~~tk~L~V~l~~~~~~~~~~lS~~vDL~~~L  223 (281)
T 3ujo_A          151 YNGGW-DPTERHIGIDVNSIK-SIKTTSW-----DFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVL  223 (281)
T ss_dssp             CCCSS-CCSSSEEEEEESSSC-CSCEEEC-----CCCSSCCEEEEEEECTTTCEEEEEEECTTTCCCEEEEEECCSTTTS
T ss_pred             ccccC-CCCCCeEEEEcCCCC-ccccccc-----cccCCCEEEEEEEEeCCCCEEEEEEecCCCCCCceEEEEechHHhc
Confidence            99 77 999999999999998 7776654     57799999999999996                          568


Q ss_pred             ccceeEEEEeccCc---cccccccccceeecccc
Q 047367          206 PNAVYVGFTASTGL---LQESHQLLDRVFVSFPI  236 (579)
Q Consensus       206 ~~~~~vGfsastg~---~~~~~~i~~w~f~~~~~  236 (579)
                      ||+|||||||+||.   ..|.|+|++|+|++...
T Consensus       224 ~e~v~VGFSAsTG~~~~~~e~H~IlsWSFss~l~  257 (281)
T 3ujo_A          224 PEWVSVGFSATTGLSKGYVETNEVLSWSFASKLS  257 (281)
T ss_dssp             CSEEEEEEEEEECSSTTSCCCCEEEEEEEEEEEC
T ss_pred             cCcEEEEEEeecCCCCcccceeEEEEEEEEEEcC
Confidence            99999999999996   58999999999998654



>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 579
d1gzca_239 b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( 2e-38
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-36
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 6e-36
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 1e-35
d1leda_243 b.29.1.1 (A:) Legume lectin {West-central african 1e-35
d1hqla_236 b.29.1.1 (A:) Legume lectin {Griffonia simplicifol 5e-35
d1g7ya_253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 1e-34
g1qmo.1230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 2e-34
d1qnwa_237 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 2e-34
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-33
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 4e-33
d1fnya_237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 5e-33
d1ukga_241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 1e-32
d1dbna_239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 2e-32
d1fx5a_240 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 2e-32
d1n47a_233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 2e-32
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 4e-32
g2ltn.1229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 4e-32
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 6e-32
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 6e-32
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 7e-32
d2d3sa1237 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso 2e-31
d1g9fa_251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 2e-31
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-31
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 3e-31
d1g8wa_233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 4e-31
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-31
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 5e-31
d1f9ka_234 b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca 6e-31
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 6e-31
d1v6ia_232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 6e-31
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 9e-31
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-30
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 4e-30
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 6e-30
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 9e-30
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-29
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 7e-29
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-28
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-28
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 9e-28
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-27
d1ioaa_228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 1e-27
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-27
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 4e-27
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 9e-27
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-26
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-26
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-26
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 7e-26
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-25
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-25
d1avba_226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 4e-25
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 7e-25
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 3e-24
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 7e-24
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-23
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-23
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 6e-22
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-21
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 3e-21
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 3e-21
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 5e-21
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 6e-21
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 8e-21
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-20
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 5e-20
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 8e-20
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-19
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 1e-19
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-19
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 4e-19
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 5e-19
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 7e-18
d1nlsa_237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 9e-18
d1nlsa_237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 3e-16
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-17
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-17
d1gv9a_228 b.29.1.13 (A:) Carbohydrate-recognition domain of 1e-15
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-15
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 7e-15
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 8e-15
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 3e-14
d2a6za1221 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Bake 6e-14
d2a6va1218 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Bake 2e-13
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 4e-13
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 3e-08
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]
 Score =  139 bits (351), Expect = 2e-38
 Identities = 61/246 (24%), Positives = 96/246 (39%), Gaps = 49/246 (19%)

Query: 24  SVPITFNNFNPDSCNNGNDLICMGSVT-AGNGYLSLTPEPYSTLPPPLNKVGRVLFHQPV 82
           ++  +F+ F P      ++L   G+     +G L LT    + +P   +  GR L+ +PV
Sbjct: 3   TISFSFSEFEP----GNDNLTLQGAALITQSGVLQLTKINQNGMPAW-DSTGRTLYTKPV 57

Query: 83  LAW------PAMFTTTFTVRISKFPDATGSGDGMAFVMAQDNKPPPPNGYGSYLGIMDKS 136
             W       A F T F+  I +        DG+ F M      P       YLG+ + S
Sbjct: 58  HMWDSTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGY--GYLGVFNNS 115

Query: 137 TQDGVVRQLAVELDTYMNEYMIPDGNHIGVDTTSMATPVAAKSLNSTGIDLKSGRNITVK 196
            QD   + LAVE DT+ N +  P   HIG+D  S+      +S+ +    L +G+   V 
Sbjct: 116 KQDNSYQTLAVEFDTFSNPWDPPQVPHIGIDVNSI------RSIKTQPFQLDNGQVANVV 169

Query: 197 IDYDGAKT--------------------------VPNAVYVGFTASTGL---LQESHQLL 227
           I YD                              +P+ V VG + +TG      E+H + 
Sbjct: 170 IKYDAPSKILHVVLVYPSSGAIYTIAEIVDVKQVLPDWVDVGLSGATGAQRDAAETHDVY 229

Query: 228 DRVFVS 233
              F +
Sbjct: 230 SWSFQA 235


>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query579
d1hqla_236 Legume lectin {Griffonia simplicifolia, lectin I-b 100.0
d1leda_243 Legume lectin {West-central african legume (Griffo 100.0
d1fx5a_240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 100.0
d1gzca_239 Legume lectin {Cockspur coral tree (Erythrina cris 100.0
d2d3sa1237 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1qnwa_237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 100.0
d1n47a_233 Legume lectin {Hairy vetch (Vicia villosa), isolec 100.0
d1dbna_239 Legume lectin {Maackia amurensis, leukoagglutinin 100.0
d1g9fa_251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 100.0
d1f9ka_234 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1g7ya_253 Legume lectin {Horse gram (Dolichos biflorus), dif 100.0
g1qmo.1230 Legume lectin {Field bean (Dolichos lablab), Fril 100.0
d1g8wa_233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1fnya_237 Legume lectin {Black locust (Robinia pseudoacacia) 100.0
d1v6ia_232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 100.0
g2ltn.1229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 100.0
d1ukga_241 Legume lectin {Bloodwood tree (Pterocarpus angolen 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1ioaa_228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1avba_226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.97
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.97
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.97
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.97
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.97
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.97
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.97
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.97
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.97
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.97
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.97
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.96
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.96
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.96
d1gv9a_228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 99.91
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.9
d1nlsa_237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 99.89
d1nlsa_237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 99.87
d2a6za1221 Emp47p N-terminal domain {Baker's yeast (Saccharom 99.79
d2a6va1218 Emp46p N-terminal domain {Baker's yeast (Saccharom 99.77
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.95
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 82.54
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]
Probab=100.00  E-value=5.2e-47  Score=369.64  Aligned_cols=199  Identities=35%  Similarity=0.545  Sum_probs=166.3

Q ss_pred             ccceecCCCCCCCCCCCCCeEEecceeecCCeeEcCCCCCCCC-CCCCCceEEEEecCccccCC-----ce-eEEEEEEE
Q 047367           24 SVPITFNNFNPDSCNNGNDLICMGSVTAGNGYLSLTPEPYSTL-PPPLNKVGRVLFHQPVLAWP-----AM-FTTTFTVR   96 (579)
Q Consensus        24 ~~~f~f~~f~~~~~~~~~~l~~~g~a~~~~~~l~LT~~~~~~~-~~~~~~~Gr~~y~~pv~l~~-----~~-F~t~F~F~   96 (579)
                      +.+|+|++|+++.   ..+|+|+|||.+.+|.|+||+.  ... .+...++|||+|++||+||+     ++ |+|+|+|.
T Consensus         1 ~~sF~f~~F~~~~---~~~l~l~G~A~~~~~~l~LT~~--~~~~~~~~~s~Gra~y~~Pv~l~~~~t~~~asFsT~F~F~   75 (236)
T d1hqla_           1 SVSFTFPNFWSDV---EDSIIFQGDANTTAGTLQLCKT--NQYGTPLQWSAGRALYSDPVQLWDNKTESVASFYTEFTFF   75 (236)
T ss_dssp             CCEEEESCSCSCG---GGTEEEEETCEEETTEEECSCB--CTTSCBCSSCEEEEEESSCEECCCSTTCCCCEEEEEEEEE
T ss_pred             CEEEEeCCCCCCC---cCCEEEeccEEecCCEEEEecC--CCCCcccccceEEEEECCCEEeecCCCCceeEEEEEEEEE
Confidence            3689999998643   4589999999999999999986  322 23467899999999999998     45 99999999


Q ss_pred             EecCCCCCCCCCceEEEEccCCCCCCCCCCCCccccccCCCCCC-CCc-eeEEEeecCCC-CCCCCCCCeeeeecCCCcc
Q 047367           97 ISKFPDATGSGDGMAFVMAQDNKPPPPNGYGSYLGIMDKSTQDG-VVR-QLAVELDTYMN-EYMIPDGNHIGVDTTSMAT  173 (579)
Q Consensus        97 i~~~~~~~~~gdG~aF~l~~~~~~~~~~~~g~~lGl~~~~~~~~-~~~-~~aVEfDt~~n-~~~D~~~~HvGidvns~~~  173 (579)
                      |.+.  ...+||||||||+|.+.  +.+..|++||+++..+++. ..+ .+||||||++| +++||++||||||+||+. 
T Consensus        76 i~~~--~~~~gDGlAFvl~p~~~--~~~~~G~~lGl~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHIgIdvns~~-  150 (236)
T d1hqla_          76 LKIT--GNGPADGLAFFLAPPDS--DVKDAGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNFPEPSYRHIGINVNSIV-  150 (236)
T ss_dssp             EEEC--SSCCCCEEEEEEECTTC--CCCCCGGGTTTSCTTTTTCGGGCCCEEEEEECSCCSSSCCCSSCEEEEEESSSS-
T ss_pred             EeCC--CCCCCceEEEEEeCCCC--CCCCCccccccccccccCCcccCceEEEEeeCccCCCCCCCCCCEEEEEcCCcc-
Confidence            9874  45689999999999643  4567899999999876543 234 46999999999 677999999999999998 


Q ss_pred             cccccccCCCCcccCCCceEEEEEEeCCC-------------------------cccccceeEEEEeccCcc-ccccccc
Q 047367          174 PVAAKSLNSTGIDLKSGRNITVKIDYDGA-------------------------KTVPNAVYVGFTASTGLL-QESHQLL  227 (579)
Q Consensus       174 s~~~~~~~~~~~~~~~g~~~~~~I~yd~~-------------------------~~l~~~~~vGfsastg~~-~~~~~i~  227 (579)
                      |..+..+.  ..++.+|+.++|||+||+.                         .+|+++||||||||||.. .+.|+|+
T Consensus       151 s~~~~~~~--~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~~~~~~~ls~~vdL~~~l~~~v~vGFSasTG~~~~~~h~I~  228 (236)
T d1hqla_         151 SVATKRWE--DSDIFSGKIATARISYDGSAEILTVVLSYPDGSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTVYIL  228 (236)
T ss_dssp             CSEEEECC--HHHHTSCSCEEEEEEEETTTTEEEEEEEETTTEEEEEEEECCGGGTSCSEEEEEEEEECCSCCCEEEEEE
T ss_pred             cccccccc--cccccCCCEEEEEEEEeCCCcEEEEEEecCCCCCeeEEEEeCHHHhCCCcEEEEEEeECCCCCceEEEEE
Confidence            66665553  4578999999999999987                         568999999999999975 5779999


Q ss_pred             cceeecc
Q 047367          228 DRVFVSF  234 (579)
Q Consensus       228 ~w~f~~~  234 (579)
                      +|+|+++
T Consensus       229 sWsF~s~  235 (236)
T d1hqla_         229 SWRFSSN  235 (236)
T ss_dssp             EEEEEEE
T ss_pred             EeEeEec
Confidence            9999974



>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure