Citrus Sinensis ID: 047379


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
RSSDKETLDEFKSAGAASPLLGLVCYFAAAREVFFGATKQSKMVTSKKTKKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGDH
ccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHccHHHHHccHHHHHHHHHHHHHHccEEEEHHHHHHHHHccccCEEEEccccccHHHHHHHHHHHHcccEEEECcccccHHHHHHccccEEEEEEEEcccccHHHccccccc
******T***FKSAGAASPLLGLVCYFAAAREVFFGAT*****************INNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLP***
xxxxxxxxxxxxxxHxxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RSSDKETLDEFKSAGAASPLLGLVCYFAAAREVFFGATKQSKMVTSKKTKKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGDH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L30 probableP67883
60S ribosomal protein L30 probableO49884
60S ribosomal protein L30 probableP62890

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VI6, chain A
Confidence level:very confident
Coverage over the Query: 51-147
View the alignment between query and template
View the model in PyMOL
Template: 1G2R, chain A
Confidence level:probable
Coverage over the Query: 20-48
View the alignment between query and template
View the model in PyMOL