Citrus Sinensis ID: 047379

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
RSSDKETLDEFKSAGAASPLLGLVCYFAAAREVFFGATKQSKMVTSKKTKKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGDH
ccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccHHHcHHHHHHcHHHHHHHHHHHHHHccEEEEHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHccccEEEEEEEEccccHHHHHcccccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHcHHHHcccccHHHHHHHHHHHHHcEEEEcHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHcccEEEEccccHHHHHHHccccccccEEEEEEcccccccccccccc
rssdketldefksagaasplLGLVCYFAAAREVFFgatkqskmvtskktkktHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGkliilsnncpplrkSEIEYYAMLAKVGVhhyngnnvdlgtaCGKYFRVSclsiidpgdsdiikslpgdh
rssdketldefksagaasplLGLVCYFAAAREVFFgatkqskmvtskktkkthesinNRLALVMKSGKYTLGYKTVLRSLrtskgkliilsnncpplRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSiidpgdsdiikslpgdh
RSSDKETLDEFKSAGAASPLLGLVCYFAAAREVFFGAtkqskmvtskktkktHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGDH
*****************SPLLGLVCYFAAAREVFFGAT*****************INNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPG************
******T***FKSAGAASPLLGLVCYFAAAREVFFGA**********************LALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLP***
***********KSAGAASPLLGLVCYFAAAREVFFGATK**************ESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGDH
****KETLDEFKSAGAASPLLGLVCYFAAAREVFFGATKQSKMVT******THESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDI********
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RSSDKETLDEFKSAGAASPLLGLVCYFAAAREVFFGATKQSKMVTSKKTKKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGDH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
O49884112 60S ribosomal protein L30 N/A no 0.727 1.0 0.901 4e-56
Q9M5M6112 60S ribosomal protein L30 N/A no 0.727 1.0 0.892 5e-55
Q8VZ19112 60S ribosomal protein L30 yes no 0.727 1.0 0.875 3e-54
Q9C8F7112 Putative 60S ribosomal pr no no 0.727 1.0 0.866 8e-54
Q9LSA3112 60S ribosomal protein L30 no no 0.727 1.0 0.848 6e-53
O48558112 60S ribosomal protein L30 N/A no 0.727 1.0 0.803 1e-49
Q9SDG6111 60S ribosomal protein L30 yes no 0.694 0.963 0.831 3e-48
P67884115 60S ribosomal protein L30 N/A no 0.707 0.947 0.743 2e-44
P67883115 60S ribosomal protein L30 yes no 0.707 0.947 0.743 2e-44
P62890115 60S ribosomal protein L30 yes no 0.707 0.947 0.743 2e-44
>sp|O49884|RL30_LUPLU 60S ribosomal protein L30 OS=Lupinus luteus GN=RPL30 PE=3 SV=1 Back     alignment and function desciption
 Score =  216 bits (551), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 109/112 (97%)

Query: 43  MVTSKKTKKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEI 102
           MV +KKTKKTHESINNRLALVMKSGKYTLGYKTVL+SLR+SKGKLII++NNCPPLRKSEI
Sbjct: 1   MVAAKKTKKTHESINNRLALVMKSGKYTLGYKTVLKSLRSSKGKLIIIANNCPPLRKSEI 60

Query: 103 EYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGDH 154
           EYYAMLAKVGVHHYNGNNVDLGTACGKY+RV CLSI+DPGDSDIIK+LPGD 
Sbjct: 61  EYYAMLAKVGVHHYNGNNVDLGTACGKYYRVCCLSIVDPGDSDIIKTLPGDQ 112

Lupinus luteus (taxid: 3873)
>sp|Q9M5M6|RL30_EUPES 60S ribosomal protein L30 OS=Euphorbia esula GN=RPL30 PE=3 SV=1 Back     alignment and function description
>sp|Q8VZ19|RL302_ARATH 60S ribosomal protein L30-2 OS=Arabidopsis thaliana GN=RPL30B PE=3 SV=1 Back     alignment and function description
>sp|Q9C8F7|RL301_ARATH Putative 60S ribosomal protein L30-1 OS=Arabidopsis thaliana GN=RPL30A PE=3 SV=1 Back     alignment and function description
>sp|Q9LSA3|RL303_ARATH 60S ribosomal protein L30-3 OS=Arabidopsis thaliana GN=RPL30C PE=3 SV=1 Back     alignment and function description
>sp|O48558|RL30_MAIZE 60S ribosomal protein L30 OS=Zea mays GN=RPL30 PE=3 SV=1 Back     alignment and function description
>sp|Q9SDG6|RL30_ORYSJ 60S ribosomal protein L30 OS=Oryza sativa subsp. japonica GN=RPL30 PE=3 SV=1 Back     alignment and function description
>sp|P67884|RL30_OPHHA 60S ribosomal protein L30 OS=Ophiophagus hannah GN=RPL30 PE=3 SV=2 Back     alignment and function description
>sp|P67883|RL30_CHICK 60S ribosomal protein L30 OS=Gallus gallus GN=RPL30 PE=3 SV=2 Back     alignment and function description
>sp|P62890|RL30_RAT 60S ribosomal protein L30 OS=Rattus norvegicus GN=Rpl30 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
255576194112 60S ribosomal protein L30, putative [Ric 0.727 1.0 0.946 2e-56
282848250112 60S ribosomal protein L30 [Jatropha curc 0.727 1.0 0.937 2e-56
224081200112 predicted protein [Populus trichocarpa] 0.727 1.0 0.928 8e-56
224104913112 predicted protein [Populus trichocarpa] 0.727 1.0 0.937 1e-55
224093800112 predicted protein [Populus trichocarpa] 0.727 1.0 0.928 1e-55
225438619112 PREDICTED: 60S ribosomal protein L30 [Vi 0.727 1.0 0.928 1e-55
118484785112 unknown [Populus trichocarpa] 0.727 1.0 0.928 4e-55
255552912112 60S ribosomal protein L30, putative [Ric 0.727 1.0 0.901 9e-55
388510578112 unknown [Lotus japonicus] 0.727 1.0 0.910 2e-54
6094048112 RecName: Full=60S ribosomal protein L30 0.727 1.0 0.901 2e-54
>gi|255576194|ref|XP_002528991.1| 60S ribosomal protein L30, putative [Ricinus communis] gi|223531581|gb|EEF33410.1| 60S ribosomal protein L30, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/112 (94%), Positives = 109/112 (97%)

Query: 43  MVTSKKTKKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEI 102
           M   KKTKKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLII+SNNCPPLRKSEI
Sbjct: 1   MAAGKKTKKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIIISNNCPPLRKSEI 60

Query: 103 EYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGDH 154
           EYYAML+KVGVHHYNGNNVDLGTACGKYFRVSCLSI+DPGDSDIIKSLPGDH
Sbjct: 61  EYYAMLSKVGVHHYNGNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSLPGDH 112

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|282848250|gb|ADB02906.1| 60S ribosomal protein L30 [Jatropha curcas] Back     alignment and taxonomy information
>gi|224081200|ref|XP_002306331.1| predicted protein [Populus trichocarpa] gi|118484057|gb|ABK93914.1| unknown [Populus trichocarpa] gi|118485363|gb|ABK94539.1| unknown [Populus trichocarpa] gi|222855780|gb|EEE93327.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224104913|ref|XP_002313617.1| predicted protein [Populus trichocarpa] gi|224131730|ref|XP_002328094.1| predicted protein [Populus trichocarpa] gi|118483895|gb|ABK93838.1| unknown [Populus trichocarpa] gi|222837609|gb|EEE75974.1| predicted protein [Populus trichocarpa] gi|222850025|gb|EEE87572.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224093800|ref|XP_002309997.1| predicted protein [Populus trichocarpa] gi|118481493|gb|ABK92689.1| unknown [Populus trichocarpa] gi|118483057|gb|ABK93438.1| unknown [Populus trichocarpa] gi|222852900|gb|EEE90447.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225438619|ref|XP_002281037.1| PREDICTED: 60S ribosomal protein L30 [Vitis vinifera] gi|296082469|emb|CBI21474.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|118484785|gb|ABK94261.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255552912|ref|XP_002517499.1| 60S ribosomal protein L30, putative [Ricinus communis] gi|223543510|gb|EEF45041.1| 60S ribosomal protein L30, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388510578|gb|AFK43355.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|6094048|sp|O49884.1|RL30_LUPLU RecName: Full=60S ribosomal protein L30 gi|2879811|emb|CAA11256.1| ribosomal protein L30 [Lupinus luteus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
TAIR|locus:2029401112 AT1G77940 [Arabidopsis thalian 0.655 0.901 0.891 1.1e-46
TAIR|locus:2013205112 AT1G36240 [Arabidopsis thalian 0.655 0.901 0.891 1.8e-46
TAIR|locus:2093984112 RLK902 "receptor-like kinase 9 0.655 0.901 0.881 3.8e-46
UNIPROTKB|G1K316108 RPL30 "60S ribosomal protein L 0.636 0.907 0.755 8.9e-38
UNIPROTKB|P67883115 RPL30 "60S ribosomal protein L 0.636 0.852 0.755 8.9e-38
UNIPROTKB|Q3T0D5115 RPL30 "60S ribosomal protein L 0.636 0.852 0.755 8.9e-38
UNIPROTKB|E5RI99114 RPL30 "60S ribosomal protein L 0.636 0.859 0.755 8.9e-38
UNIPROTKB|P62888115 RPL30 "60S ribosomal protein L 0.636 0.852 0.755 8.9e-38
UNIPROTKB|F2Z554115 RPL30 "Uncharacterized protein 0.636 0.852 0.755 8.9e-38
MGI|MGI:98037115 Rpl30 "ribosomal protein L30" 0.636 0.852 0.755 8.9e-38
TAIR|locus:2029401 AT1G77940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 489 (177.2 bits), Expect = 1.1e-46, P = 1.1e-46
 Identities = 90/101 (89%), Positives = 98/101 (97%)

Query:    53 HESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVG 112
             HE IN+RLALVMKSGKYTLGYK+VL+SLR SKGKLI++S NCPPLR+SEIEYYAMLAKVG
Sbjct:    11 HEGINSRLALVMKSGKYTLGYKSVLKSLRGSKGKLILISTNCPPLRRSEIEYYAMLAKVG 70

Query:   113 VHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSLPGD 153
             VHHYNGNNVDLGTACGKYFRVSCLSI+DPGDSDIIKS+PGD
Sbjct:    71 VHHYNGNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSIPGD 111
GO:0003735 "structural constituent of ribosome" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005840 "ribosome" evidence=IEA
GO:0006412 "translation" evidence=IEA;ISS
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0022625 "cytosolic large ribosomal subunit" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
TAIR|locus:2013205 AT1G36240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093984 RLK902 "receptor-like kinase 902" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G1K316 RPL30 "60S ribosomal protein L30" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P67883 RPL30 "60S ribosomal protein L30" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0D5 RPL30 "60S ribosomal protein L30" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E5RI99 RPL30 "60S ribosomal protein L30" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P62888 RPL30 "60S ribosomal protein L30" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z554 RPL30 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:98037 Rpl30 "ribosomal protein L30" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P67883RL30_CHICKNo assigned EC number0.74310.70770.9478yesno
P67884RL30_OPHHANo assigned EC number0.74310.70770.9478N/Ano
Q5I7K9RL30_WHEATNo assigned EC number0.780.64930.8928N/Ano
O49884RL30_LUPLUNo assigned EC number0.90170.72721.0N/Ano
P62890RL30_RATNo assigned EC number0.74310.70770.9478yesno
P52808RL30A_SCHPONo assigned EC number0.65380.67530.9541yesno
O48558RL30_MAIZENo assigned EC number0.80350.72721.0N/Ano
Q9SDG6RL30_ORYSJNo assigned EC number0.83170.69480.9639yesno
Q76KA2RL30_MACFANo assigned EC number0.74310.70770.9478N/Ano
Q9M5M6RL30_EUPESNo assigned EC number0.89280.72721.0N/Ano
Q6FXZ0RL30_CANGANo assigned EC number0.610.64930.9523yesno
Q3T0D5RL30_BOVINNo assigned EC number0.74310.70770.9478yesno
Q8VZ19RL302_ARATHNo assigned EC number0.8750.72721.0yesno
P14120RL30_YEASTNo assigned EC number0.610.64930.9523yesno
Q55BS9RL30_DICDINo assigned EC number0.62030.70120.9642yesno
Q6C4U7RL30_YARLINo assigned EC number0.56730.67530.9541yesno
Q752U5RL30_ASHGONo assigned EC number0.590.64930.9523yesno
P58372RL30_ICTPUNo assigned EC number0.70530.72720.9655N/Ano
P58375RL30_SPOFRNo assigned EC number0.72470.70770.9646N/Ano
P58374RL30_BRABENo assigned EC number0.71020.69480.9385N/Ano
P62888RL30_HUMANNo assigned EC number0.74310.70770.9478yesno
P62889RL30_MOUSENo assigned EC number0.74310.70770.9478yesno
P39095RL30_LEIMANo assigned EC number0.56430.65580.9711yesno
P38664RL30_KLULANo assigned EC number0.590.64930.9523yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
PTZ00106108 PTZ00106, PTZ00106, 60S ribosomal protein L30; Pro 3e-64
COG1911100 COG1911, RPL30, Ribosomal protein L30E [Translatio 4e-44
PRK0101899 PRK01018, PRK01018, 50S ribosomal protein L30e; Re 2e-28
pfam0124895 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/ 2e-25
COG1358116 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L3 6e-05
>gnl|CDD|185450 PTZ00106, PTZ00106, 60S ribosomal protein L30; Provisional Back     alignment and domain information 
 Score =  191 bits (487), Expect = 3e-64
 Identities = 73/107 (68%), Positives = 90/107 (84%)

Query: 44  VTSKKTKKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIE 103
           +  KK KK  ESIN++L LVMKSGKYTLG K+ L++LR  K KL+I+SNNCPP+R+SEIE
Sbjct: 1   MMKKKKKKAQESINSKLQLVMKSGKYTLGTKSTLKALRNGKAKLVIISNNCPPIRRSEIE 60

Query: 104 YYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSL 150
           YYAML+K GVHHY GNN DLGTACG++FRVS +SI D GDSDI+++L
Sbjct: 61  YYAMLSKTGVHHYAGNNNDLGTACGRHFRVSVMSITDAGDSDILRAL 107

Length = 108
>gnl|CDD|224823 COG1911, RPL30, Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179205 PRK01018, PRK01018, 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>gnl|CDD|216387 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family Back     alignment and domain information
>gnl|CDD|224277 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
PRK09190220 hypothetical protein; Provisional 100.0
PTZ00106108 60S ribosomal protein L30; Provisional 99.97
PRK0728398 hypothetical protein; Provisional 99.97
PRK05583104 ribosomal protein L7Ae family protein; Provisional 99.97
PRK07714100 hypothetical protein; Provisional 99.97
PRK0101899 50S ribosomal protein L30e; Reviewed 99.96
TIGR03677117 rpl7ae 50S ribosomal protein L7Ae. Multifunctional 99.95
PRK04175122 rpl7ae 50S ribosomal protein L7Ae; Validated 99.95
PF0124895 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/G 99.91
COG1358116 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Tr 99.91
PRK0668382 hypothetical protein; Provisional 99.9
PRK1360282 putative ribosomal protein L7Ae-like; Provisional 99.9
COG1911100 RPL30 Ribosomal protein L30E [Translation, ribosom 99.89
PRK1360182 putative L7Ae-like ribosomal protein; Provisional 99.87
PRK1360084 putative ribosomal protein L7Ae-like; Provisional 99.78
KOG2988112 consensus 60S ribosomal protein L30 [Translation, 99.68
PTZ00222263 60S ribosomal protein L7a; Provisional 99.67
PTZ00365266 60S ribosomal protein L7Ae-like; Provisional 99.57
KOG3167153 consensus Box H/ACA snoRNP component, involved in 99.48
KOG3387131 consensus 60S ribosomal protein 15.5kD/SNU13, NHP2 99.23
KOG3406134 consensus 40S ribosomal protein S12 [Translation, 99.1
cd0027979 YlxR Ylxr homologs; group of conserved hypothetica 98.56
PF0429678 DUF448: Protein of unknown function (DUF448); Inte 98.52
COG274095 Predicted nucleic-acid-binding protein implicated 98.16
PF0803276 SpoU_sub_bind: RNA 2'-O ribose methyltransferase s 97.35
PF08228158 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR0 96.31
PF03465113 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This do 96.02
TIGR00111351 pelota probable translation factor pelota. This mo 95.8
TIGR03676403 aRF1/eRF1 peptide chain release factor 1, archaeal 95.7
TIGR00108409 eRF peptide chain release factor eRF/aRF, subunit 94.7
PRK04011411 peptide chain release factor 1; Provisional 94.59
PRK11181 244 23S rRNA (guanosine-2'-O-)-methyltransferase; Prov 94.08
TIGR00186 237 rRNA_methyl_3 rRNA methylase, putative, group 3. t 91.87
cd01422115 MGS Methylglyoxal synthase catalyzes the enolizati 91.79
PRK10864 346 putative methyltransferase; Provisional 91.42
PRK05234142 mgsA methylglyoxal synthase; Validated 89.34
PRK12566 954 glycine dehydrogenase; Provisional 88.22
PF0214295 MGS: MGS-like domain This is a subfamily of this f 88.18
PF1008797 DUF2325: Uncharacterized protein conserved in bact 86.37
COG0566 260 SpoU rRNA methylases [Translation, ribosomal struc 86.12
cd00532112 MGS-like MGS-like domain. This domain composes the 85.59
smart0085190 MGS MGS-like domain. This domain composes the whol 85.42
cd01424110 MGS_CPS_II Methylglyoxal synthase-like domain from 82.31
>PRK09190 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.9e-36  Score=245.75  Aligned_cols=129  Identities=18%  Similarity=0.229  Sum_probs=122.7

Q ss_pred             cccchhhhhcchhHHHHHhhhhhhhhhhh-------------hhhHHHHHHHHHHHHHHhCCceecHHHHHHHHhcCCce
Q 047379           20 LLGLVCYFAAAREVFFGATKQSKMVTSKK-------------TKKTHESINNRLALVMKSGKYTLGYKTVLRSLRTSKGK   86 (154)
Q Consensus        20 ~~grg~y~~~~~~~~~~a~~~~~~~~~~k-------------~~~~~~kil~lLglA~rAGklv~G~~~VlkaIk~gkak   86 (154)
                      +-|||||.|.+++|++.|.+|+.|.|+||             +..+.++++++||||+|||++++|+++|+++|++|+++
T Consensus        50 ~pGRGaYvc~~~~c~~~A~kkk~l~Ralk~~v~v~~~l~~~l~~~l~~ril~lLGLArRAGklVsG~~~V~~alk~gk~~  129 (220)
T PRK09190         50 LPGRGCWVSADRAAVEKAVAKKLFARAAKADVKVPPDLADLVEALLARRALDALGLARKAGQVVSGFEKVDAALRSGEAA  129 (220)
T ss_pred             CCCCEEEEcCCHHHHHHHHHhChhHHHhCCCCCCCHHHHHHHHHHHHHHHHHHHHHHhhhCCEeecHHHHHHHHHcCCce
Confidence            46999999999999999999999999999             55667999999999999999999999999999999999


Q ss_pred             EEEEeCCCChhhhhhHHHHHHh------CCCcEEEecCCHHHHHhhhCCcccEEEEEEeCcCchHHHhcC
Q 047379           87 LIILSNNCPPLRKSEIEYYAML------AKVGVHHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSL  150 (154)
Q Consensus        87 LVIlA~Das~~~k~ki~~~c~~------~~Vpvi~~~~tkeELG~a~Gk~~~vsvvaI~D~GfA~~i~~~  150 (154)
                      |||+|+|+|++++++|.++|+.      ++||++. .+|++|||.++|+++++ +++|+|.||++.|.+.
T Consensus       130 Lvi~A~DaS~~t~kKl~~~~~~~~~~~~~~Vp~v~-~~tk~eLg~AlGr~~~~-~vav~d~gfA~~l~~~  197 (220)
T PRK09190        130 ALIHASDGAADGKRKLDQARRALVHETGREIPVIG-LFTAAELGLAFGRENVI-HAALLAGGAAERVVKR  197 (220)
T ss_pred             EEEEeccCChhHHHHHHHHHHhhcccccCCccEEE-ecCHHHHHHHhCCCcee-EEEEcChHHHHHHHHH
Confidence            9999999999999999999999      9999996 89999999999999787 7999999999998764

>PTZ00106 60S ribosomal protein L30; Provisional Back     alignment and domain information
>PRK07283 hypothetical protein; Provisional Back     alignment and domain information
>PRK05583 ribosomal protein L7Ae family protein; Provisional Back     alignment and domain information
>PRK07714 hypothetical protein; Provisional Back     alignment and domain information
>PRK01018 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>TIGR03677 rpl7ae 50S ribosomal protein L7Ae Back     alignment and domain information
>PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>PF01248 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; InterPro: IPR004038 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG1358 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06683 hypothetical protein; Provisional Back     alignment and domain information
>PRK13602 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>COG1911 RPL30 Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13601 putative L7Ae-like ribosomal protein; Provisional Back     alignment and domain information
>PRK13600 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>KOG2988 consensus 60S ribosomal protein L30 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00222 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>PTZ00365 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>KOG3167 consensus Box H/ACA snoRNP component, involved in ribosomal RNA pseudouridinylation [RNA processing and modification] Back     alignment and domain information
>KOG3387 consensus 60S ribosomal protein 15 Back     alignment and domain information
>KOG3406 consensus 40S ribosomal protein S12 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00279 YlxR Ylxr homologs; group of conserved hypothetical bacterial proteins of unknown function; structure revealed putative RNA binding cleft; proteins are encoded by an operon that includes other proteins involved in transcription and/or translation Back     alignment and domain information
>PF04296 DUF448: Protein of unknown function (DUF448); InterPro: IPR007393 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>COG2740 Predicted nucleic-acid-binding protein implicated in transcription termination [Transcription] Back     alignment and domain information
>PF08032 SpoU_sub_bind: RNA 2'-O ribose methyltransferase substrate binding; InterPro: IPR013123 Most cellular RNAs undergo a number of post-transcriptional nucleoside modifications Back     alignment and domain information
>PF08228 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR013241 This family of fungal proteins form a subunit of RNase P, the ribonucleoprotein enzyme that cleaves the leader sequence of precursor tRNAs to generate mature tRNAs Back     alignment and domain information
>PF03465 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This domain is found in the release factor eRF1 which terminates protein biosynthesis by recognizing stop codons at the A site of the ribosome and stimulating peptidyl-tRNA bond hydrolysis at the peptidyl transferase centre Back     alignment and domain information
>TIGR00111 pelota probable translation factor pelota Back     alignment and domain information
>TIGR03676 aRF1/eRF1 peptide chain release factor 1, archaeal and eukaryotic forms Back     alignment and domain information
>TIGR00108 eRF peptide chain release factor eRF/aRF, subunit 1 Back     alignment and domain information
>PRK04011 peptide chain release factor 1; Provisional Back     alignment and domain information
>PRK11181 23S rRNA (guanosine-2'-O-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00186 rRNA_methyl_3 rRNA methylase, putative, group 3 Back     alignment and domain information
>cd01422 MGS Methylglyoxal synthase catalyzes the enolization of dihydroxyacetone phosphate (DHAP) to produce methylglyoxal Back     alignment and domain information
>PRK10864 putative methyltransferase; Provisional Back     alignment and domain information
>PRK05234 mgsA methylglyoxal synthase; Validated Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PF02142 MGS: MGS-like domain This is a subfamily of this family; InterPro: IPR011607 This domain composes the whole protein of methylglyoxal synthetase and the domain is also found in carbamoyl phosphate synthetase (CPS) where it forms a regulatory domain that binds to the allosteric effector ornithine Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG0566 SpoU rRNA methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00532 MGS-like MGS-like domain Back     alignment and domain information
>smart00851 MGS MGS-like domain Back     alignment and domain information
>cd01424 MGS_CPS_II Methylglyoxal synthase-like domain from type II glutamine-dependent carbamoyl phosphate synthetase (CSP) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
1ysh_C104 Localization And Dynamic Behavior Of Ribosomal Prot 1e-44
2zkr_6115 Structure Of A Mammalian Ribosomal 60s Subunit With 1e-41
3vi6_A125 Crystal Structure Of Human L30e Length = 125 2e-41
3izr_f112 Localization Of The Large Subunit Ribosomal Protein 8e-40
4a18_G104 T.Thermophila 60s Ribosomal Subunit In Complex With 7e-32
1ck2_A104 Yeast (Saccharomyces Cerevisiae) Ribosomal Protein 3e-31
1t0k_B105 Joint X-ray And Nmr Refinement Of Yeast L30e-mrna C 3e-31
3jyw_298 Structure Of The 60s Proteins For Eukaryotic Riboso 5e-31
3zf7_g105 High-resolution Cryo-electron Microscopy Structure 7e-31
2bo1_A101 Crystal Structure Of A Hybrid Ribosomal Protein L30 3e-18
3j21_Z99 Promiscuous Behavior Of Proteins In Archaeal Riboso 6e-15
3n4z_A101 Crystal Structure Of Quintuple Arg-To-Lys Variant O 3e-13
1w3e_X101 Ribosomal L30e Of Thermococcus Celer, P59a Mutant L 8e-13
1w40_A101 T. Celer L30e K9a Variant Length = 101 1e-12
3n4y_A101 Crystal Structure Of Wild-Type T. Celer L30e In Low 2e-12
1w42_A101 T. Celer L30e R92a Variant Length = 101 2e-12
3ra5_A101 Crystal Structure Of T. Celer L30e E6aR92A VARIANT 2e-12
1h7m_A102 Ribosomal Protein L30e From Thermococcus Celer Leng 2e-12
1w41_A101 T.Celer L30e E90a Variant Length = 101 4e-12
3lfo_A101 Crystal Structure Of T. Celer L30e E90aR92A VARIANT 4e-12
3ra6_A101 Crystal Structure Of T. Celer L30e E62aK46A VARIANT 1e-11
3cpq_A110 Crystal Structure Of L30e A Ribosomal Protein From 1e-11
>pdb|1YSH|C Chain C, Localization And Dynamic Behavior Of Ribosomal Protein L30e Length = 104 Back     alignment and structure 
Iteration: 1

 Score =  174 bits (442), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 92/96 (95%)
Query: 54  ESINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGV 113
           E+INN+L LVMKSGKYTLGYKTVL++LR+SKGKLIIL+NNCPPLRKSEIEYYAMLAK+ V
Sbjct: 7   ENINNKLQLVMKSGKYTLGYKTVLKTLRSSKGKLIILANNCPPLRKSEIEYYAMLAKISV 66
Query: 114 HHYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKS 149
           HH++GNNVDLGTACGKY+RV CLSI+DPGDSDII +
Sbjct: 67  HHFHGNNVDLGTACGKYYRVCCLSILDPGDSDIIST 102
>pdb|2ZKR|6 Chain 6, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 115 Back     alignment and structure
>pdb|3VI6|A Chain A, Crystal Structure Of Human L30e Length = 125 Back     alignment and structure
>pdb|3IZR|FF Chain f, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 112 Back     alignment and structure
>pdb|4A18|G Chain G, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 104 Back     alignment and structure
>pdb|1CK2|A Chain A, Yeast (Saccharomyces Cerevisiae) Ribosomal Protein L30 Length = 104 Back     alignment and structure
>pdb|1T0K|B Chain B, Joint X-ray And Nmr Refinement Of Yeast L30e-mrna Complex Length = 105 Back     alignment and structure
>pdb|3JYW|2 Chain 2, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 98 Back     alignment and structure
>pdb|3ZF7|GG Chain g, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 105 Back     alignment and structure
>pdb|2BO1|A Chain A, Crystal Structure Of A Hybrid Ribosomal Protein L30e With Surface Residues From T. Celer, And Core Residues From Yeast Length = 101 Back     alignment and structure
>pdb|3J21|Z Chain Z, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (50s Ribosomal Proteins) Length = 99 Back     alignment and structure
>pdb|3N4Z|A Chain A, Crystal Structure Of Quintuple Arg-To-Lys Variant Of T. Celer L30e Length = 101 Back     alignment and structure
>pdb|1W3E|X Chain X, Ribosomal L30e Of Thermococcus Celer, P59a Mutant Length = 101 Back     alignment and structure
>pdb|1W40|A Chain A, T. Celer L30e K9a Variant Length = 101 Back     alignment and structure
>pdb|3N4Y|A Chain A, Crystal Structure Of Wild-Type T. Celer L30e In Low Ionic Strength Condition Without Precipitant Length = 101 Back     alignment and structure
>pdb|1W42|A Chain A, T. Celer L30e R92a Variant Length = 101 Back     alignment and structure
>pdb|3RA5|A Chain A, Crystal Structure Of T. Celer L30e E6aR92A VARIANT Length = 101 Back     alignment and structure
>pdb|1H7M|A Chain A, Ribosomal Protein L30e From Thermococcus Celer Length = 102 Back     alignment and structure
>pdb|1W41|A Chain A, T.Celer L30e E90a Variant Length = 101 Back     alignment and structure
>pdb|3LFO|A Chain A, Crystal Structure Of T. Celer L30e E90aR92A VARIANT Length = 101 Back     alignment and structure
>pdb|3RA6|A Chain A, Crystal Structure Of T. Celer L30e E62aK46A VARIANT Length = 101 Back     alignment and structure
>pdb|3CPQ|A Chain A, Crystal Structure Of L30e A Ribosomal Protein From Methanocaldococcus Jannaschii Dsm2661 (Mj1044) Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
3iz5_F190 60S ribosomal protein L9 (L6P); eukaryotic ribosom 3e-54
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 8e-53
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 1e-49
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 3e-49
1w41_A101 50S ribosomal protein L30E; electrostatic interact 2e-47
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 1e-46
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 6e-30
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 1e-29
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 2e-17
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 1e-15
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 2e-11
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 2e-11
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 5e-06
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 3e-05
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Length = 125 Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Length = 105 Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Length = 110 Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Length = 101 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Length = 104 Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Length = 101 Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Length = 101 Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Length = 124 Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Length = 120 Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Length = 119 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Length = 120 Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Length = 82 Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Length = 121 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
3iz5_f112 60S ribosomal protein L30 (L30E); eukaryotic ribos 99.97
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 99.97
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 99.97
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 99.96
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 99.96
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 99.96
3j21_Z99 50S ribosomal protein L30E; archaea, archaeal, KIN 99.96
1w41_A101 50S ribosomal protein L30E; electrostatic interact 99.95
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 99.95
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 99.94
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 99.94
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.94
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 99.94
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 99.93
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 99.92
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 99.92
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.92
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 99.91
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 99.89
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 99.88
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 99.84
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 99.74
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 99.69
2kg4_A165 Growth arrest and DNA-damage-inducible protein GA 99.67
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 99.64
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 99.53
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 99.36
3cg6_A146 Growth arrest and DNA-damage-inducible 45 gamma; a 99.11
3ffm_A167 Growth arrest and DNA-damage-inducible protein GAD 98.99
1g2r_A100 Hypothetical cytosolic protein; NUSA-INFB operon, 98.43
3ir9_A166 Peptide chain release factor subunit 1; structural 95.95
3oby_A352 Protein pelota homolog; SM fold, hydrolase; 2.90A 94.97
1gz0_A 253 Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O 94.85
2qi2_A347 Pelota, cell division protein pelota related prote 94.84
3nk6_A 277 23S rRNA methyltransferase; nosiheptide, nosihepti 94.0
3obw_A364 Protein pelota homolog; SM fold, hydrolase; 2.60A 94.0
1x52_A124 Pelota homolog, CGI-17; ERF1_3 domain, structural 93.73
3j15_A357 Protein pelota; ribosome recycling, ribosome, arch 93.67
1ipa_A 274 RRMH, RNA 2'-O-ribose methyltransferase; DEEP tref 92.51
2vgn_A386 DOM34; translation termination factor, protein bio 92.44
2xw6_A134 MGS, methylglyoxal synthase; lyase; 1.08A {Thermus 91.63
3mca_B390 Protein DOM34, elongation factor 1 alpha-like prot 91.61
3agj_B358 Protein pelota homolog; GTP binding, translation-h 91.57
3e20_C441 Eukaryotic peptide chain release factor subunit 1; 90.61
1b93_A152 Protein (methylglyoxal synthase); glycolytic bypas 90.29
3agk_A373 Peptide chain release factor subunit 1; translatio 89.54
1vmd_A178 MGS, methylglyoxal synthase; TM1185, structural ge 88.9
1x7o_A 287 Avirb, rRNA methyltransferase; SPOU, C-terminal kn 84.76
2yvq_A143 Carbamoyl-phosphate synthase; conserved hypothetic 83.57
1dt9_A437 ERF1, protein (eukaryotic peptide chain release fa 81.24
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 80.31
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 4b6a_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Back     alignment and structure
>3j21_Z 50S ribosomal protein L30E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Back     alignment and structure
>3cg6_A Growth arrest and DNA-damage-inducible 45 gamma; alpha/beta, cell cycle; 1.70A {Mus musculus} PDB: 2wal_A Back     alignment and structure
>3ffm_A Growth arrest and DNA-damage-inducible protein GADD45 gamma; beta-turn-helix, cell cycle; 2.30A {Homo sapiens} Back     alignment and structure
>1g2r_A Hypothetical cytosolic protein; NUSA-INFB operon, structural genomics, PSI, protein structure initiative; 1.35A {Streptococcus pneumoniae} SCOP: d.192.1.1 Back     alignment and structure
>3ir9_A Peptide chain release factor subunit 1; structural genomics, APC36528.1, C-terminal domain, PSI-2, protein structure initiative; 2.21A {Methanosarcina mazei} Back     alignment and structure
>3oby_A Protein pelota homolog; SM fold, hydrolase; 2.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1gz0_A Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>2qi2_A Pelota, cell division protein pelota related protein; DOM34, cell cycle; 2.90A {Thermoplasma acidophilum} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 Back     alignment and structure
>3nk6_A 23S rRNA methyltransferase; nosiheptide, nosiheptide-resistance methyltransferase, 23S R methyltransferase; 2.00A {Streptomyces actuosus} PDB: 3nk7_A* 3gyq_A* Back     alignment and structure
>3obw_A Protein pelota homolog; SM fold, hydrolase; 2.60A {Sulfolobus solfataricus} Back     alignment and structure
>1x52_A Pelota homolog, CGI-17; ERF1_3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.79.3.2 Back     alignment and structure
>3j15_A Protein pelota; ribosome recycling, ribosome, archaea, translation-transport complex; HET: ADP; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1ipa_A RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil knot, rossmann fold, EL30-like fold, riken structural genomics/proteomics initiative; 2.40A {Thermus thermophilus} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>2vgn_A DOM34; translation termination factor, protein biosynthesis, translation regulation, cell division, mRNA degradation; 2.5A {Saccharomyces cerevisiae} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 PDB: 2vgm_A 3izq_0 3j16_A* Back     alignment and structure
>2xw6_A MGS, methylglyoxal synthase; lyase; 1.08A {Thermus SP} PDB: 2x8w_A 1wo8_A Back     alignment and structure
>3mca_B Protein DOM34, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3agj_B Protein pelota homolog; GTP binding, translation-hydrolase complex; HET: GTP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>3e20_C Eukaryotic peptide chain release factor subunit 1; SUP35, SUP45, translation termination, peptide release, GTP- nucleotide-binding; 3.50A {Schizosaccharomyces pombe} Back     alignment and structure
>1b93_A Protein (methylglyoxal synthase); glycolytic bypass, lyase; 1.90A {Escherichia coli} SCOP: c.24.1.2 PDB: 1egh_A 1ik4_A* 1s8a_A 1s89_A Back     alignment and structure
>3agk_A Peptide chain release factor subunit 1; translation; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1vmd_A MGS, methylglyoxal synthase; TM1185, structural genomics, JCSG, P structure initiative, PSI, joint center for structural GENO lyase; 2.06A {Thermotoga maritima} SCOP: c.24.1.2 Back     alignment and structure
>1x7o_A Avirb, rRNA methyltransferase; SPOU, C-terminal knot, seMet; 2.37A {Streptomyces viridochromogenes} PDB: 1x7p_A* Back     alignment and structure
>2yvq_A Carbamoyl-phosphate synthase; conserved hypothetical protein, structural genomics, NPPSFA; 1.98A {Homo sapiens} Back     alignment and structure
>1dt9_A ERF1, protein (eukaryotic peptide chain release factor subunit 1); tRNA mimicry, protein sythesis, STOP codon recognition, peptidyl-tRNA hydrolysis; 2.70A {Homo sapiens} SCOP: c.55.4.2 d.79.3.2 d.91.1.1 PDB: 3e1y_A* 2ktu_A 2ktv_A 2lgt_A 2hst_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d1t0kb_97 d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L3 2e-41
d2bo1a1100 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L3 7e-37
d1w3ex198 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 5e-36
d2fc3a1124 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyr 1e-27
d1vqof1119 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeo 1e-21
d1rlga_113 d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Arc 1e-20
d1xbia1115 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeo 7e-20
d2aifa1115 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Crypto 2e-19
d2ozba1125 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Hu 1e-15
d2alea1126 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein 4e-11
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Eukaryotic ribosomal protein L30 (L30e)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  131 bits (332), Expect = 2e-41
 Identities = 59/96 (61%), Positives = 77/96 (80%)

Query: 55  SINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVH 114
           SIN +LALV+KSGKYTLGYK+ ++SLR  K KLII++ N P LRKSE+EYYAML+K  V+
Sbjct: 1   SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVY 60

Query: 115 HYNGNNVDLGTACGKYFRVSCLSIIDPGDSDIIKSL 150
           ++ G N +LGTA GK FRV  +SI++ GDSDI+ +L
Sbjct: 61  YFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTL 96
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 100 Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 98 Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Length = 124 Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Length = 115 Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Length = 126 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d1t0kb_97 Eukaryotic ribosomal protein L30 (L30e) {Baker's y 99.96
d1w3ex198 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.95
d2bo1a1100 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.95
d1vqof1119 Ribosomal protein L7ae {Archaeon Haloarcula marism 99.94
d2fc3a1124 Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 5 99.93
d1rlga_113 Ribosomal protein L7ae {Archaeon Archaeoglobus ful 99.93
d2aifa1115 Ribosomal protein L7ae {Cryptosporidium parvum [Ta 99.92
d1xbia1115 Ribosomal protein L7ae {Archaeon Methanococcus jan 99.91
d2alea1126 Small nuclear ribonucleoprotein-associated protein 99.89
d2ozba1125 Spliceosomal 15.5kd protein {Human (Homo sapiens) 99.88
d1g2ra_94 Hypothetical cytosolic protein SP0554 {Streptococc 98.35
d1gz0a276 RlmB, N-terminal domain {Escherichia coli [TaxId: 97.83
d2vgna3104 Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} 96.12
d1x52a1111 Cell division protein pelota {Human (Homo sapiens) 96.01
d1dt9a2146 C-terminal domain of eukaryotic peptide chain rele 95.83
d2qi2a395 Cell division protein pelota {Thermoplasma acidoph 95.6
d1wo8a1126 Methylglyoxal synthase, MgsA {Thermus thermophilus 89.35
d1b93a_148 Methylglyoxal synthase, MgsA {Escherichia coli [Ta 87.33
d1ipaa2105 RrmA (RrmH), N-terminal domain {Thermus thermophil 87.26
d1vmda_156 Methylglyoxal synthase, MgsA {Thermotoga maritima 82.7
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Eukaryotic ribosomal protein L30 (L30e)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.96  E-value=6.3e-30  Score=182.21  Aligned_cols=96  Identities=61%  Similarity=0.973  Sum_probs=91.3

Q ss_pred             HHHHHHHHHHHhCCceecHHHHHHHHhcCCceEEEEeCCCChhhhhhHHHHHHhCCCcEEEecCCHHHHHhhhCCcccEE
Q 047379           55 SINNRLALVMKSGKYTLGYKTVLRSLRTSKGKLIILSNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVS  134 (154)
Q Consensus        55 kil~lLglA~rAGklv~G~~~VlkaIk~gkakLVIlA~Das~~~k~ki~~~c~~~~Vpvi~~~~tkeELG~a~Gk~~~vs  134 (154)
                      .|.++|++|+|+|++++|.++|+++|++|++++||+|+|+||++++++..+|+.++||++.|.+|++|||.+||++++++
T Consensus         1 ~I~~~L~la~Kagklv~G~~~v~k~i~~gkaklVilA~D~~~~~~~~i~~~~~~~~vp~~~~~~t~~eLG~a~Gk~~~vs   80 (97)
T d1t0kb_           1 SINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVG   80 (97)
T ss_dssp             CHHHHHHHHHHSSCEEESHHHHHHHHHHTCCSEEEECTTCCHHHHHHHHHHHHHHTCEEEECSSCHHHHHHHTTCSSCCS
T ss_pred             CHHHHHHHHHHhCCeeEcHHHHHHHHHcCCCcEEEEeCCCCHHHHHHHHHHHHhcCCceEEEcCCHHHHHHHhCCCCCEE
Confidence            37899999999999999999999999999999999999999999999999999999998766789999999999999988


Q ss_pred             EEEEeCcCchHHHhcC
Q 047379          135 CLSIIDPGDSDIIKSL  150 (154)
Q Consensus       135 vvaI~D~GfA~~i~~~  150 (154)
                      +++|+|+|++++|..+
T Consensus        81 ~v~I~d~G~s~~~~~l   96 (97)
T d1t0kb_          81 VVSILEAGDSDILTTL   96 (97)
T ss_dssp             EEEECCCSSCCTTTTT
T ss_pred             EEEEeccchHHHHHhc
Confidence            9999999999988765
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2ra_ d.192.1.1 (A:) Hypothetical cytosolic protein SP0554 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1gz0a2 d.79.3.3 (A:2-77) RlmB, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vgna3 d.79.3.2 (A:278-381) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qi2a3 d.79.3.2 (A:244-338) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wo8a1 c.24.1.2 (A:1-126) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b93a_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ipaa2 d.79.3.3 (A:1-105) RrmA (RrmH), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vmda_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure