Citrus Sinensis ID: 047387


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MDSSFCFQYPYSQFSPEYSSSSYSHNTNNSLESFTYKTFNNFHNNHQYLPFNENDSQEMLLLEVLNQASANSMHTISSTSNNNNIKDDHEVSSRAVNATEEGPLKEVSYRGVRRRPWGKYAAEIRDSTRNGVRVWIGTFDTAEAAALAYDQAAFAMRGTTAVLNFPVEKVYESLLEMKYDFEVGSSPVLTLKKRHSMKRKGESKKKIKEKEMRLENVVVFEDLGTEYLEELLSISDSTC
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccEEEEEccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHccccEEEcccccHHHHHHHHccccccc
*DSSFCFQYP**********************SFTYKTFNNFHNNHQYLPFNENDSQEMLLLEV********************************************YRGVRRRPWGKYAAEIRDSTRNGVRVWIGTFDTAEAAALAYDQAAFAMRGTTAVLNFPVEKVYESLLEMKYD*********************************LENVVVFEDLGTEYLEELLSISD***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSSFCFQYPYSQFSPEYSSSSYSHNTNNSLESFTYKTFNNFHNNHQYLPFNENDSQEMLLLEVLNQASANSMHTISSTSNNNNIKDDHEVSSRAVNATEEGPLKEVSYRGVRRRPWGKYAAEIRDSTRNGVRVWIGTFDTAEAAALAYDQAAFAMRGTTAVLNFPVEKVYESLLEMKYDFEVGSSPVLTLKKRHSMKRKGESKKKIKEKEMRLENVVVFEDLGTEYLEELLSISDSTC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ethylene-responsive transcription factor 1B Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression during the plant development, and/or mediated by stress factors and by components of stress signal transduction pathways. Seems to be a key integrator of ethylene and jasmonate signals in the regulation of ethylene/jasmonate-dependent defenses. Can mediate resistance to necrotizing fungi (Botrytis cinerea and Plectosphaerella cucumerina) and to soil borne fungi (Fusarium oxysporum conglutinans and Fusiarium oxysporum lycopersici), but probably not to necrotizing bacteria (Pseudomonas syringae tomato).probableQ8LDC8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 108-168
View the alignment between query and template
View the model in PyMOL