Citrus Sinensis ID: 047402

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MLSLKPLRLANDKATTNATIGDGCHRQEGSSPFSLPSSGVTEIATNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHALGNTTNDPTLTVLDKNTVLQMMKNCHDCDLGNANVRDDVVDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSPSGGHELSKTTGNAGGRVACGIIGIQG
ccccccccccccHHHHHccccccccccccccccccccccEEEEEEccccEEEEcccccEEEEEEEEcccccccEEEEEcccccccccccccccccccccccccccccccccEEEcccEEEEEEEcccccccccEEEEEccccccccccccccccccccccccccccccEEEEEEEEEc
ccccccccccccccEEEEEEcccccccccccccEEEcccEEEEEEEEcccEEEEcccEEEEEEEEEccccEEEEEEEEcccccccHHHcccccccccccccccccccccccEEEccEEEEcccEccHHHEccccEEEEEccccccccccccccccccHHHcccccccccEEEEcEEcc
mlslkplrlandkattnatigdgchrqegsspfslpssgvteiatnrsddlimgdggqttvtgsfsglkpglhgfhvhalgnttndptltvldKNTVLQMMknchdcdlgnanvrddvvdnqislsgpnsiiGRAVVvhsdpdnlgkecsspsgghelskttgnaggrvacgiigiqg
mlslkplrlanDKATTNATIGDGCHRQEgsspfslpssgVTEIATNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHAlgnttndptLTVLDKNTVLQMMKNCHDCDLGNANVRDDVVDNQISlsgpnsiigRAVVVHSDPDNLGKEcsspsgghelskttgnaggrvaCGIIGIQG
MLSLKPLRLANDKATTNATIGDGCHRQEGSSPFSLPSSGVTEIATNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHALGNTTNDPTLTVLDKNTVLQMMKNCHDCDLGNANVRDDVVDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSPSGGHELSKTTGNAGGRVACGIIGIQG
**********************************************************TTVTGSFSGLKPGLHGFHVHALGNTTNDPTLTVLDKNTVLQMMKNCHDCDLGNANVRDDVVDNQISLSGPNSIIGRAVVV*****************************RVACGIIG***
**S*KP*RLANDKATTNAT********************VTEIATNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHALGNTTNDPTLTVLDKNTVLQMMKNCHDCDLGNANVRDDVVDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSP*********TGNAGGRVACGIIGIQG
MLSLKPLRLANDKATTNATIGDGCHRQEGSSPFSLPSSGVTEIATNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHALGNTTNDPTLTVLDKNTVLQMMKNCHDCDLGNANVRDDVVDNQISLSGPNSIIGRAVVVHSDPDNL****************TGNAGGRVACGIIGIQG
**SLKPLRLANDKATTNATIGDGCHRQEGSSPFSLPSSGVTEIATNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHALGNTTNDPTLTVLDKNTVLQMMKNCHDCDLGNANVRDDVVDNQISLSGPNSIIGRAVVVHSDPDNLGKEC***************AGGRVACGIIGIQG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSLKPLRLANDKATTNATIGDGCHRQEGSSPFSLPSSGVTEIATNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHALGNTTNDPTLTVLDKNTVLQMMKNCHDCDLGNANVRDDVVDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSPSGGHELSKTTGNAGGRVACGIIGIQG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
Q0DRV6152 Superoxide dismutase [Cu- yes no 0.747 0.875 0.576 8e-33
A2XGP6152 Superoxide dismutase [Cu- N/A no 0.747 0.875 0.576 8e-33
Q8L5E0152 Superoxide dismutase [Cu- N/A no 0.651 0.763 0.609 1e-32
P23345152 Superoxide dismutase [Cu- N/A no 0.651 0.763 0.616 2e-32
O65768152 Superoxide dismutase [Cu- N/A no 0.651 0.763 0.601 3e-32
Q9SQL5152 Superoxide dismutase [Cu- N/A no 0.651 0.763 0.616 4e-32
Q7M1R5152 Superoxide dismutase [Cu- no no 0.651 0.763 0.624 5e-32
P23346152 Superoxide dismutase [Cu- N/A no 0.651 0.763 0.609 5e-32
P11428151 Superoxide dismutase [Cu- N/A no 0.651 0.768 0.593 7e-32
P93258152 Superoxide dismutase [Cu- N/A no 0.651 0.763 0.578 9e-32
>sp|Q0DRV6|SODC1_ORYSJ Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa subsp. japonica GN=SODCC1 PE=1 SV=1 Back     alignment and function desciption
 Score =  139 bits (351), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 87/151 (57%), Positives = 98/151 (64%), Gaps = 18/151 (11%)

Query: 39  GVTEIATNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHALGNTTN-----DPTLTVLD 93
           G +EI       +  GDG  TTVTGS SGLKPGLHGFH+HALG+TTN      P      
Sbjct: 9   GSSEIVKGTIHFVQEGDG-PTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTGPHYNPAG 67

Query: 94  KNTVLQMMKNCHDCDLGNANVRDD------VVDNQISLSGPNSIIGRAVVVHSDPDNLGK 147
           K       +  H  DLGN    +D      VVD+QI L+GPNSIIGRAVVVH+DPD+LGK
Sbjct: 68  KEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHADPDDLGK 127

Query: 148 ECSSPSGGHELSKTTGNAGGRVACGIIGIQG 178
                 GGHELSKTTGNAGGRVACGIIG+QG
Sbjct: 128 ------GGHELSKTTGNAGGRVACGIIGLQG 152
Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 1EC: .EC: 1EC: 5EC: .EC: 1EC: .EC: 1
>sp|A2XGP6|SODC1_ORYSI Superoxide dismutase [Cu-Zn] 1 OS=Oryza sativa subsp. indica GN=SODCC1 PE=2 SV=2 Back     alignment and function description
>sp|Q8L5E0|ALL5B_OLEEU Superoxide dismutase [Cu-Zn] 2 OS=Olea europaea GN=OLE5 PE=1 SV=2 Back     alignment and function description
>sp|P23345|SODC4_MAIZE Superoxide dismutase [Cu-Zn] 4A OS=Zea mays GN=SODCC.3 PE=2 SV=2 Back     alignment and function description
>sp|O65768|SODC_CARPA Superoxide dismutase [Cu-Zn] OS=Carica papaya GN=SODCC PE=2 SV=1 Back     alignment and function description
>sp|Q9SQL5|SODC_ANACO Superoxide dismutase [Cu-Zn] OS=Ananas comosus GN=SOD1 PE=2 SV=1 Back     alignment and function description
>sp|Q7M1R5|SODC_SOYBN Superoxide dismutase [Cu-Zn] OS=Glycine max GN=SOD1 PE=3 SV=1 Back     alignment and function description
>sp|P23346|SODC5_MAIZE Superoxide dismutase [Cu-Zn] 4AP OS=Zea mays GN=SODCC.2 PE=2 SV=2 Back     alignment and function description
>sp|P11428|SODC2_MAIZE Superoxide dismutase [Cu-Zn] 2 OS=Zea mays GN=SODCC.1 PE=2 SV=2 Back     alignment and function description
>sp|P93258|SODC1_MESCR Superoxide dismutase [Cu-Zn] 1 OS=Mesembryanthemum crystallinum GN=SODCC.1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
381141812152 Cu/Zn superoxide dismutase [Tetradium ru 0.651 0.763 0.661 1e-34
111434271130 Cu/Zn superoxide dismutase [Eucalyptus c 0.651 0.892 0.646 2e-33
33340236152 copper/zinc superoxide dismutase [Citrus 0.651 0.763 0.654 2e-33
373938697125 copper/zinc superoxide dismutase, partia 0.640 0.912 0.656 5e-33
373938703125 copper/zinc superoxide dismutase, partia 0.640 0.912 0.656 6e-33
164654158152 copper/zinc-superoxide dismutase [Litchi 0.646 0.756 0.621 7e-33
373938707125 copper/zinc superoxide dismutase, partia 0.640 0.912 0.648 2e-32
224130836152 predicted protein [Populus trichocarpa] 0.651 0.763 0.624 2e-32
255542450152 cu/zn superoxide dismutase, putative [Ri 0.651 0.763 0.631 2e-32
224125448152 predicted protein [Populus trichocarpa] 0.651 0.763 0.616 2e-32
>gi|381141812|gb|AFF57842.1| Cu/Zn superoxide dismutase [Tetradium ruticarpum] Back     alignment and taxonomy information
 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 94/133 (70%), Gaps = 17/133 (12%)

Query: 57  GQTTVTGSFSGLKPGLHGFHVHALGNTTN-----DPTLTVLDKNTVLQMMKNCHDCDLGN 111
           G TTVTGS SGLKPGLHGFHVHALG+TTN      P      K       +N H  DLGN
Sbjct: 26  GPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDENRHAGDLGN 85

Query: 112 ANVRDD------VVDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSPSGGHELSKTTGNA 165
            NV DD      +VDNQI LSGPNSIIGRAVVVH+DPD+LGK      GGHELSKTTGNA
Sbjct: 86  VNVGDDGTATFTIVDNQIPLSGPNSIIGRAVVVHADPDDLGK------GGHELSKTTGNA 139

Query: 166 GGRVACGIIGIQG 178
           GGRVACGIIG+QG
Sbjct: 140 GGRVACGIIGLQG 152

Source: Tetradium ruticarpum

Species: Tetradium ruticarpum

Genus: Tetradium

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|111434271|gb|ABH10014.1| Cu/Zn superoxide dismutase [Eucalyptus camaldulensis] Back     alignment and taxonomy information
>gi|33340236|gb|AAQ14591.1| copper/zinc superoxide dismutase [Citrus limon] Back     alignment and taxonomy information
>gi|373938697|gb|AEY79511.1| copper/zinc superoxide dismutase, partial [Tetradium ruticarpum] gi|373938701|gb|AEY79513.1| copper/zinc superoxide dismutase, partial [Tetradium ruticarpum] Back     alignment and taxonomy information
>gi|373938703|gb|AEY79514.1| copper/zinc superoxide dismutase, partial [Tetradium ruticarpum] Back     alignment and taxonomy information
>gi|164654158|gb|ABY65355.1| copper/zinc-superoxide dismutase [Litchi chinensis] gi|436805717|gb|AGB58021.1| copper/zinc-superoxide dismutase [Litchi chinensis] Back     alignment and taxonomy information
>gi|373938707|gb|AEY79516.1| copper/zinc superoxide dismutase, partial [Tetradium ruticarpum] gi|373938711|gb|AEY79518.1| copper/zinc superoxide dismutase, partial [Tetradium ruticarpum] Back     alignment and taxonomy information
>gi|224130836|ref|XP_002328388.1| predicted protein [Populus trichocarpa] gi|118482058|gb|ABK92960.1| unknown [Populus trichocarpa] gi|118484653|gb|ABK94197.1| unknown [Populus trichocarpa] gi|125863282|gb|ABN58428.1| Cu-Zn superoxide dismutase [Populus trichocarpa] gi|222838103|gb|EEE76468.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542450|ref|XP_002512288.1| cu/zn superoxide dismutase, putative [Ricinus communis] gi|223548249|gb|EEF49740.1| cu/zn superoxide dismutase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224125448|ref|XP_002319589.1| predicted protein [Populus trichocarpa] gi|118488274|gb|ABK95956.1| unknown [Populus trichocarpa] gi|222857965|gb|EEE95512.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
UNIPROTKB|Q0DRV6152 SODCC1 "Superoxide dismutase [ 0.747 0.875 0.576 3.6e-34
UNIPROTKB|P28757152 SODCC2 "Superoxide dismutase [ 0.662 0.776 0.602 4.7e-32
TAIR|locus:2025595152 CSD1 "copper/zinc superoxide d 0.662 0.776 0.595 7.7e-32
TAIR|locus:2046168216 CSD2 "copper/zinc superoxide d 0.674 0.555 0.496 1.8e-25
UNIPROTKB|Q0DTX5162 Os03g0219200 "Superoxide dismu 0.646 0.709 0.522 2.2e-25
TAIR|locus:2172324164 CSD3 "AT5G18100" [Arabidopsis 0.646 0.701 0.507 1.2e-24
UNIPROTKB|P93407211 SODCP "Superoxide dismutase [C 0.674 0.568 0.481 1.1e-23
FB|FBgn0003462153 Sod "Superoxide dismutase" [Dr 0.646 0.751 0.454 9e-22
UNIPROTKB|F1MNQ4152 F1MNQ4 "Superoxide dismutase [ 0.646 0.756 0.454 7.2e-20
UNIPROTKB|Q8HXQ0154 SOD1 "Superoxide dismutase [Cu 0.640 0.740 0.465 7.2e-20
UNIPROTKB|Q0DRV6 SODCC1 "Superoxide dismutase [Cu-Zn] 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 371 (135.7 bits), Expect = 3.6e-34, P = 3.6e-34
 Identities = 87/151 (57%), Positives = 98/151 (64%)

Query:    39 GVTEIATNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHALGNTTND-----PTLTVLD 93
             G +EI       +  GDG  TTVTGS SGLKPGLHGFH+HALG+TTN      P      
Sbjct:     9 GSSEIVKGTIHFVQEGDG-PTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTGPHYNPAG 67

Query:    94 KNTVLQMMKNCHDCDLGNANVRDD------VVDNQISLSGPNSIIGRAVVVHSDPDNLGK 147
             K       +  H  DLGN    +D      VVD+QI L+GPNSIIGRAVVVH+DPD+LGK
Sbjct:    68 KEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHADPDDLGK 127

Query:   148 ECSSPSGGHELSKTTGNAGGRVACGIIGIQG 178
                   GGHELSKTTGNAGGRVACGIIG+QG
Sbjct:   128 ------GGHELSKTTGNAGGRVACGIIGLQG 152
GO:0004784 "superoxide dismutase activity" evidence=IBA
GO:0005507 "copper ion binding" evidence=IBA
GO:0008270 "zinc ion binding" evidence=IBA
GO:0019430 "removal of superoxide radicals" evidence=IBA
UNIPROTKB|P28757 SODCC2 "Superoxide dismutase [Cu-Zn] 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2025595 CSD1 "copper/zinc superoxide dismutase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046168 CSD2 "copper/zinc superoxide dismutase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0DTX5 Os03g0219200 "Superoxide dismutase [Cu-Zn]" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2172324 CSD3 "AT5G18100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93407 SODCP "Superoxide dismutase [Cu-Zn], chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
FB|FBgn0003462 Sod "Superoxide dismutase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNQ4 F1MNQ4 "Superoxide dismutase [Cu-Zn]" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXQ0 SOD1 "Superoxide dismutase [Cu-Zn]" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P24704SODC1_ARATH1, ., 1, 5, ., 1, ., 10.59390.65160.7631yesno
Q0DRV6SODC1_ORYSJ1, ., 1, 5, ., 1, ., 10.57610.74710.875yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.10.914
3rd Layer1.15.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
PLN02386152 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] 4e-42
cd00305144 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc s 2e-27
pfam00080140 pfam00080, Sod_Cu, Copper/zinc superoxide dismutas 3e-27
PLN02642164 PLN02642, PLN02642, copper, zinc superoxide dismut 2e-26
COG2032179 COG2032, SodC, Cu/Zn superoxide dismutase [Inorgan 6e-16
>gnl|CDD|166027 PLN02386, PLN02386, superoxide dismutase [Cu-Zn] Back     alignment and domain information 
 Score =  138 bits (348), Expect = 4e-42
 Identities = 83/133 (62%), Positives = 92/133 (69%), Gaps = 17/133 (12%)

Query: 57  GQTTVTGSFSGLKPGLHGFHVHALGNTTN-----DPTLTVLDKNTVLQMMKNCHDCDLGN 111
           G TTVTGS SGLKPGLHGFHVHALG+TTN      P      K       +N H  DLGN
Sbjct: 26  GPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDENRHAGDLGN 85

Query: 112 ANVRDD------VVDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSPSGGHELSKTTGNA 165
             V DD      +VD QI L+GPNSI+GRAVVVH+DPD+LGK      GGHELSK+TGNA
Sbjct: 86  VTVGDDGTATFTIVDKQIPLTGPNSIVGRAVVVHADPDDLGK------GGHELSKSTGNA 139

Query: 166 GGRVACGIIGIQG 178
           GGRVACGIIG+QG
Sbjct: 140 GGRVACGIIGLQG 152

Length = 152
>gnl|CDD|238186 cd00305, Cu-Zn_Superoxide_Dismutase, Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>gnl|CDD|215700 pfam00080, Sod_Cu, Copper/zinc superoxide dismutase (SODC) Back     alignment and domain information
>gnl|CDD|178248 PLN02642, PLN02642, copper, zinc superoxide dismutase Back     alignment and domain information
>gnl|CDD|224943 COG2032, SodC, Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
PLN02386152 superoxide dismutase [Cu-Zn] 100.0
PLN02642164 copper, zinc superoxide dismutase 100.0
PRK15388177 Cu/Zn superoxide dismutase; Provisional 100.0
PRK10290173 superoxide dismutase; Provisional 100.0
COG2032179 SodC Cu/Zn superoxide dismutase [Inorganic ion tra 100.0
KOG0441154 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Ino 100.0
cd00305144 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide 100.0
PF00080142 Sod_Cu: Copper/zinc superoxide dismutase (SODC); I 100.0
PLN02957238 copper, zinc superoxide dismutase 99.97
KOG4656247 consensus Copper chaperone for superoxide dismutas 99.96
>PLN02386 superoxide dismutase [Cu-Zn] Back     alignment and domain information 
Probab=100.00  E-value=4.1e-45  Score=289.49  Aligned_cols=128  Identities=64%  Similarity=0.981  Sum_probs=118.9

Q ss_pred             eeeEEEEEEcCCCcEEEEEEEeCCCCCceeeEEecCCCCC-----CCCccCCCCCCCCCCCCCCCCcccccceEeCCCC-
Q 047402           45 TNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHALGNTT-----NDPTLTVLDKNTVLQMMKNCHDCDLGNANVRDDV-  118 (178)
Q Consensus        45 ~~G~v~F~q~~~~~v~V~~~l~GL~pG~hg~HIHe~Gdcs-----aGgH~np~~~~hg~p~~~~~h~GDLgni~~~~~G-  118 (178)
                      +.|+|+|+|..++.++|+++|+||+||+|+|||||+|||+     +|+||||.++.|+.|++..+|+||||||+++++| 
T Consensus        14 v~G~v~f~q~~~g~v~i~~~~~GL~pG~hg~HIHe~Gd~~~g~~SaGgHfnP~~~~Hg~~~~~~~H~GDLgNi~~~~~G~   93 (152)
T PLN02386         14 VKGTIFFTQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGT   93 (152)
T ss_pred             CEEEEEEEEcCCCCEEEEEEEeCCCCCceeEEEeCCCCCCCCcccccCccCCCCCCCCCCCcccCccccccCEEECCCCe
Confidence            4699999998766799999999999999999999999985     4799999999999999889999999999999999 


Q ss_pred             -----ccceeeeCCCCCCcccEEEEecCCCCCCCCCCCCCCCCCCcccCCCCCceeeEEEEeecC
Q 047402          119 -----VDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSPSGGHELSKTTGNAGGRVACGIIGIQG  178 (178)
Q Consensus       119 -----~~~~i~L~g~~siiGRSiVIH~~~Dd~~~~~~~~~g~~~~s~~~G~aG~RiACgvI~~~~  178 (178)
                           ++++++|.++++|+|||||||+++|||++      ++++.|+++|+||+|||||||+++.
T Consensus        94 a~~~~~~~~~~L~g~~~i~GrslVIHa~~DD~~~------~~~~~s~~~G~aG~RiACgvI~~~~  152 (152)
T PLN02386         94 ATFTIVDKQIPLTGPNSIVGRAVVVHADPDDLGK------GGHELSKSTGNAGGRVACGIIGLQG  152 (152)
T ss_pred             EEEEEECCceEeCCCCccCCcEEEEEccCCCcCC------CcccccccCCCCCceEEEEEEEecC
Confidence                 46778888899999999999999999987      8899999999999999999999863

>PLN02642 copper, zinc superoxide dismutase Back     alignment and domain information
>PRK15388 Cu/Zn superoxide dismutase; Provisional Back     alignment and domain information
>PRK10290 superoxide dismutase; Provisional Back     alignment and domain information
>COG2032 SodC Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0441 consensus Cu2+/Zn2+ superoxide dismutase SOD1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00305 Cu-Zn_Superoxide_Dismutase Copper/zinc superoxide dismutase (SOD) Back     alignment and domain information
>PF00080 Sod_Cu: Copper/zinc superoxide dismutase (SODC); InterPro: IPR001424 Superoxide dismutases are ubiquitous metalloproteins that prevent damage by oxygen-mediated free radicals by catalysing the dismutation of superoxide into molecular oxygen and hydrogen peroxide [] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
2q2l_A152 Crystal Structure Of Superoxide Dismutase From P. A 5e-33
1srd_A154 Three-Dimensional Structure Of Cu,Zn-Superoxide Dis 1e-23
3km1_A154 Zinc-Reconstituted Tomato Chloroplast Superoxide Di 9e-23
3l9e_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 1e-22
3l9y_A154 Crystal Structures Of Holo And Cu-Deficient CuZNSOD 9e-22
3mnd_A152 Crystallographic Analysis Of The Cystosolic CuZN SU 2e-21
3f7k_A152 X-Ray Crystal Structure Of An Alvinella Pompejana C 2e-21
1to4_A156 Structure Of The Cytosolic Cu,Zn Sod From S. Manson 4e-21
3sod_O152 Changes In Crystallographic Structure And Thermosta 1e-18
1e9o_A152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 1e-18
1e9q_A151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 1e-18
1q0e_A152 Atomic Resolution (1.15 ) Crystal Structure Of Bovi 2e-18
1sda_O152 Crystal Structure Of Peroxynitrite-Modified Bovine 2e-18
1cob_A151 Crystal Structure Solution And Refinement Of The Se 2e-18
1e9p_A151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 2e-18
1e9q_B151 Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Leng 2e-18
1e9p_B151 Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angst 2e-18
1e9o_B152 Crystal Structure Of Bovine Sod - 1 Of 3 Length = 1 2e-18
1cb4_A151 Crystal Structure Of Copper, Zinc Superoxide Dismut 3e-18
1fun_A153 Superoxide Dismutase Mutant With Lys 136 Replaced B 5e-18
1sos_A154 Atomic Structures Of Wild-type And Thermostable Mut 5e-18
1l3n_A153 The Solution Structure Of Reduced Dimeric Copper Zi 5e-18
1n18_A154 Thermostable Mutant Of Human Superoxide Dismutase, 5e-18
1n19_A154 Structure Of The Hsod A4v Mutant Length = 154 5e-18
1xso_A150 Three-Dimensional Structure Of Xenopus Laevis Cu,Zn 5e-18
3gtv_A153 Human-Mouse Sod1 Chimera Length = 153 7e-18
2wko_F154 Structure Of Metal Loaded Pathogenic Sod1 Mutant G9 8e-18
2gbt_A153 C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 9e-18
3gzp_A153 Human Sod1 G93a Metal-Free Variant Length = 153 1e-17
3gzo_A154 Human Sod1 G93a Variant Length = 154 1e-17
2zky_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 1e-17
2e47_A156 Crystal Structure Analysis Of The Clock Protein Ea4 1e-17
2e46_A157 Crystal Structure Analysis Of The Clock Protein Ea4 1e-17
2c9s_A153 1.24 Angstroms Resolution Structure Of Zn-Zn Human 2e-17
1p1v_A153 Crystal Structure Of Fals-Associated Human Copper-Z 2e-17
1mfm_A153 Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC 2e-17
1ba9_A153 The Solution Structure Of Reduced Monomeric Superox 3e-17
4b3e_A154 Structure Of Copper-Zinc Superoxide Dismutase Compl 3e-17
3ecw_A153 Crystal Structure Of The Als-Related Pathological M 3e-17
1hl4_A154 The Structure Of Apo Type Human Cu, Zn Superoxide D 3e-17
1hl5_A153 The Structure Of Holo Type Human Cu, Zn Superoxide 3e-17
1uxm_A153 A4v Mutant Of Human Sod1 Length = 153 3e-17
3gzq_A154 Human Sod1 A4v Metal-Free Variant Length = 154 3e-17
1ptz_A153 Crystal Structure Of The Human Cu, Zn Superoxide Di 4e-17
3kbe_A157 Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Le 4e-17
2wyz_A153 L38v Sod1 Mutant Complexed With Ump Length = 153 5e-17
2xjk_A153 Monomeric Human Cu,Zn Superoxide Dismutase Length = 5e-17
2gbu_A153 C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase 5e-17
1ozu_A153 Crystal Structure Of Familial Als Mutant S134n Of H 6e-17
2wyt_A153 1.0 A Resolution Structure Of L38v Sod1 Mutant Leng 7e-17
1uxl_A153 I113t Mutant Of Human Sod1 Length = 153 1e-16
4a7g_A153 Structure Of Human I113t Sod1 Mutant Complexed With 1e-16
2vr8_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 1e-16
3cqq_A153 Human Sod1 G85r Variant, Structure Ii Length = 153 1e-16
3qqd_A154 Human Sod1 H80r Variant, P212121 Crystal Form Lengt 2e-16
2vr7_A154 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 2e-16
2vr6_A153 Crystal Structure Of G85r Als Mutant Of Human Cu,Zn 2e-16
1azv_A153 Familial Als Mutant G37r Cuznsod (Human) Length = 1 2e-16
2zkw_A159 Crystal Structure Of Human Cu-Zn Superoxide Dismuta 2e-16
1oez_W153 Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismu 2e-16
3h2q_A153 Human Sod1 H80r Variant, P21 Crystal Form Length = 2e-16
2r27_A154 Constitutively Zinc-Deficient Mutant Of Human Super 3e-16
3h2p_A153 Human Sod1 D124v Variant Length = 153 3e-16
1dsw_A153 The Solution Structure Of A Monomeric, Reduced Form 4e-16
3hff_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 4e-16
4bcy_A153 Monomeric Human Cu,zn Superoxide Dismutase, Mutatio 5e-16
3gtt_A153 Mouse Sod1 Length = 153 7e-16
3gqf_A153 Structural And Biophysical Properties Of The Pathog 1e-15
2nnx_A154 Crystal Structure Of The H46r, H48q Double Mutant O 1e-15
3ltv_A153 Mouse-Human Sod1 Chimera Length = 153 3e-15
2xjl_A153 Monomeric Human Cu,Zn Superoxide Dismutase Without 4e-14
3ce1_A168 Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE 2e-13
1sdy_A153 Structure Solution And Molecular Dynamics Refinemen 8e-12
1f1g_A154 Crystal Structure Of Yeast Cuznsod Exposed To Nitri 8e-12
1f1a_A154 Crystal Structure Of Yeast H48q Cuznsod Fals Mutant 5e-11
1f18_A154 Crystal Structure Of Yeast Copper-Zinc Superoxide D 5e-11
1jk9_A153 Heterodimer Between H48f-Ysod1 And Yccs Length = 15 6e-11
2jlp_A222 Crystal Structure Of Human Extracellular Copper-Zin 9e-11
1do5_A154 Human Copper Chaperone For Superoxide Dismutase Dom 2e-10
1b4t_A153 H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPE 2e-10
1f1d_A154 Crystal Structure Of Yeast H46c Cuznsod Mutant Leng 2e-10
4bcz_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 3e-07
4bd4_A110 Monomeric Human Cu,zn Superoxide Dismutase, Loops I 2e-06
>pdb|2Q2L|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina Length = 152 Back     alignment and structure 
Iteration: 1

 Score =  136 bits (343), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 91/133 (68%), Gaps = 17/133 (12%)
Query: 57  GQTTVTGSFSGLKPGLHGFHVHALGNTTN-----DPTLTVLDKNTVLQMMKNCHDCDLGN 111
           G TTVTG+ SGLKPGLHGFHVHALG+TTN      P      K       +  H  DLGN
Sbjct: 26  GPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGSPEDETRHAGDLGN 85
Query: 112 ANVRDD------VVDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSPSGGHELSKTTGNA 165
             V DD      +VD QI L+GP+SIIGRAVVVH+DPD+LGK      GGHELSK+TGNA
Sbjct: 86  ITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHADPDDLGK------GGHELSKSTGNA 139
Query: 166 GGRVACGIIGIQG 178
           GGR+ACGIIG+QG
Sbjct: 140 GGRIACGIIGLQG 152
>pdb|1SRD|A Chain A, Three-Dimensional Structure Of Cu,Zn-Superoxide Dismutase From Spinach At 2.0 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|3KM1|A Chain A, Zinc-Reconstituted Tomato Chloroplast Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|3L9E|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM THE SILKWORM Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|3L9Y|A Chain A, Crystal Structures Of Holo And Cu-Deficient CuZNSOD FROM The Silkworm Bombyx Mori And The Implications In Amyotrophic Lateral Sclerosis Length = 154 Back     alignment and structure
>pdb|3MND|A Chain A, Crystallographic Analysis Of The Cystosolic CuZN SUPEROXIDE DISMUTASE From Taenia Solium Length = 152 Back     alignment and structure
>pdb|3F7K|A Chain A, X-Ray Crystal Structure Of An Alvinella Pompejana Cu,Zn Superoxide Dismutase- Hydrogen Peroxide Complex Length = 152 Back     alignment and structure
>pdb|1TO4|A Chain A, Structure Of The Cytosolic Cu,Zn Sod From S. Mansoni Length = 156 Back     alignment and structure
>pdb|3SOD|O Chain O, Changes In Crystallographic Structure And Thermostability Of A Cu,Zn Superoxide Dismutase Mutant Resulting From The Removal Of Buried Cysteine Length = 152 Back     alignment and structure
>pdb|1E9O|A Chain A, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1E9Q|A Chain A, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1Q0E|A Chain A, Atomic Resolution (1.15 ) Crystal Structure Of Bovine Copper, Zinc Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1SDA|O Chain O, Crystal Structure Of Peroxynitrite-Modified Bovine Cu,Zn Superoxide Dismutase Length = 152 Back     alignment and structure
>pdb|1COB|A Chain A, Crystal Structure Solution And Refinement Of The Semisynthetic Cobalt Substituted Bovine Erythrocyte Enzyme Superoxide Dismutase At 2.0 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|1E9P|A Chain A, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9Q|B Chain B, Crystal Structure Of Bovine Cu Zn Sod-(1 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9P|B Chain B, Crystal Structure Of Bovine Cu, Zn Sod To 1.7 Angstrom (3 Of 3) Length = 151 Back     alignment and structure
>pdb|1E9O|B Chain B, Crystal Structure Of Bovine Sod - 1 Of 3 Length = 152 Back     alignment and structure
>pdb|1CB4|A Chain A, Crystal Structure Of Copper, Zinc Superoxide Dismutase Length = 151 Back     alignment and structure
>pdb|1FUN|A Chain A, Superoxide Dismutase Mutant With Lys 136 Replaced By Glu, Cys 6 Replaced By Ala And Cys 111 Replaced By Ser (K136e, C6a, C111s) Length = 153 Back     alignment and structure
>pdb|1SOS|A Chain A, Atomic Structures Of Wild-type And Thermostable Mutant Recombinant Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1L3N|A Chain A, The Solution Structure Of Reduced Dimeric Copper Zinc Sod: The Structural Effects Of Dimerization Length = 153 Back     alignment and structure
>pdb|1N18|A Chain A, Thermostable Mutant Of Human Superoxide Dismutase, C6a, C111s Length = 154 Back     alignment and structure
>pdb|1N19|A Chain A, Structure Of The Hsod A4v Mutant Length = 154 Back     alignment and structure
>pdb|1XSO|A Chain A, Three-Dimensional Structure Of Xenopus Laevis Cu,Zn Superoxide Dismutase B Determined By X-Ray Crystallography At 1.5 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|3GTV|A Chain A, Human-Mouse Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|2WKO|F Chain F, Structure Of Metal Loaded Pathogenic Sod1 Mutant G93a Length = 154 Back     alignment and structure
>pdb|2GBT|A Chain A, C6aC111A CUZN SUPEROXIDE DISMUTASE Length = 153 Back     alignment and structure
>pdb|3GZP|A Chain A, Human Sod1 G93a Metal-Free Variant Length = 153 Back     alignment and structure
>pdb|3GZO|A Chain A, Human Sod1 G93a Variant Length = 154 Back     alignment and structure
>pdb|2ZKY|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G93a Length = 159 Back     alignment and structure
>pdb|2E47|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 (Glycosylation Form) Length = 156 Back     alignment and structure
>pdb|2E46|A Chain A, Crystal Structure Analysis Of The Clock Protein Ea4 Length = 157 Back     alignment and structure
>pdb|2C9S|A Chain A, 1.24 Angstroms Resolution Structure Of Zn-Zn Human Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1P1V|A Chain A, Crystal Structure Of Fals-Associated Human Copper-Zinc Superoxide Dismutase (Cuznsod) Mutant D125h To 1.4a Length = 153 Back     alignment and structure
>pdb|1MFM|A Chain A, Monomeric Human Sod Mutant F50eG51EE133Q AT ATOMIC Resolution Length = 153 Back     alignment and structure
>pdb|1BA9|A Chain A, The Solution Structure Of Reduced Monomeric Superoxide Dismutase, Nmr, 36 Structures Length = 153 Back     alignment and structure
>pdb|4B3E|A Chain A, Structure Of Copper-Zinc Superoxide Dismutase Complexed With Bicarbonate. Length = 154 Back     alignment and structure
>pdb|3ECW|A Chain A, Crystal Structure Of The Als-Related Pathological Mutant T54r Of Human Apo Cu,Zn Superoxide Dismutase (Sod1) Length = 153 Back     alignment and structure
>pdb|1HL4|A Chain A, The Structure Of Apo Type Human Cu, Zn Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|1HL5|A Chain A, The Structure Of Holo Type Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1UXM|A Chain A, A4v Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|3GZQ|A Chain A, Human Sod1 A4v Metal-Free Variant Length = 154 Back     alignment and structure
>pdb|1PTZ|A Chain A, Crystal Structure Of The Human Cu, Zn Superoxide Dismutase, Familial Amyotrophic Lateral Sclerosis (Fals) Mutant H43r Length = 153 Back     alignment and structure
>pdb|3KBE|A Chain A, Metal-Free C. Elegans Cu,Zn Superoxide Dismutase Length = 157 Back     alignment and structure
>pdb|2WYZ|A Chain A, L38v Sod1 Mutant Complexed With Ump Length = 153 Back     alignment and structure
>pdb|2XJK|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|2GBU|A Chain A, C6a/c111a/c57a/c146a Apo Cuzn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1OZU|A Chain A, Crystal Structure Of Familial Als Mutant S134n Of Human Cu, Zn Superoxide Dismutase (Cuznsod) To 1.3a Resolution Length = 153 Back     alignment and structure
>pdb|2WYT|A Chain A, 1.0 A Resolution Structure Of L38v Sod1 Mutant Length = 153 Back     alignment and structure
>pdb|1UXL|A Chain A, I113t Mutant Of Human Sod1 Length = 153 Back     alignment and structure
>pdb|4A7G|A Chain A, Structure Of Human I113t Sod1 Mutant Complexed With 4- Methylpiperazin-1-Yl)quinazoline In The P21 Space Group Length = 153 Back     alignment and structure
>pdb|2VR8|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.36 A Resolution Length = 154 Back     alignment and structure
>pdb|3CQQ|A Chain A, Human Sod1 G85r Variant, Structure Ii Length = 153 Back     alignment and structure
>pdb|3QQD|A Chain A, Human Sod1 H80r Variant, P212121 Crystal Form Length = 154 Back     alignment and structure
>pdb|2VR7|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.58 A Resolution Length = 154 Back     alignment and structure
>pdb|2VR6|A Chain A, Crystal Structure Of G85r Als Mutant Of Human Cu,Zn Superoxide Dismutase (Cuznsod) At 1.3 A Resolution Length = 153 Back     alignment and structure
>pdb|1AZV|A Chain A, Familial Als Mutant G37r Cuznsod (Human) Length = 153 Back     alignment and structure
>pdb|2ZKW|A Chain A, Crystal Structure Of Human Cu-Zn Superoxide Dismutase Mutant G85r In Space Group P21 Length = 159 Back     alignment and structure
>pdb|1OEZ|W Chain W, Zn His46arg Mutant Of Human Cu, Zn Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|3H2Q|A Chain A, Human Sod1 H80r Variant, P21 Crystal Form Length = 153 Back     alignment and structure
>pdb|2R27|A Chain A, Constitutively Zinc-Deficient Mutant Of Human Superoxide Dismutase (Sod), C6a, H80s, H83s, C111s Length = 154 Back     alignment and structure
>pdb|3H2P|A Chain A, Human Sod1 D124v Variant Length = 153 Back     alignment and structure
>pdb|1DSW|A Chain A, The Solution Structure Of A Monomeric, Reduced Form Of Human Copper, Zinc Superoxide Dismutase Bearing The Same Charge As The Native Protein Length = 153 Back     alignment and structure
>pdb|3HFF|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Zn Ligands Length = 153 Back     alignment and structure
>pdb|4BCY|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Mutation H43f Length = 153 Back     alignment and structure
>pdb|3GTT|A Chain A, Mouse Sod1 Length = 153 Back     alignment and structure
>pdb|3GQF|A Chain A, Structural And Biophysical Properties Of The Pathogenic Sod1 Variant H46rH48Q Length = 153 Back     alignment and structure
>pdb|2NNX|A Chain A, Crystal Structure Of The H46r, H48q Double Mutant Of Human [cu-Zn] Superoxide Dismutase Length = 154 Back     alignment and structure
>pdb|3LTV|A Chain A, Mouse-Human Sod1 Chimera Length = 153 Back     alignment and structure
>pdb|2XJL|A Chain A, Monomeric Human Cu,Zn Superoxide Dismutase Without Cu Ligands Length = 153 Back     alignment and structure
>pdb|3CE1|A Chain A, Crystal Structure Of The CuZN SUPEROXIDE DISMUTASE FROM Cryptococcus Liquefaciens Strain N6 Length = 168 Back     alignment and structure
>pdb|1SDY|A Chain A, Structure Solution And Molecular Dynamics Refinement Of The Yeast Cu,Zn Enzyme Superoxide Dismutase Length = 153 Back     alignment and structure
>pdb|1F1G|A Chain A, Crystal Structure Of Yeast Cuznsod Exposed To Nitric Oxide Length = 154 Back     alignment and structure
>pdb|1F1A|A Chain A, Crystal Structure Of Yeast H48q Cuznsod Fals Mutant Analog Length = 154 Back     alignment and structure
>pdb|1F18|A Chain A, Crystal Structure Of Yeast Copper-Zinc Superoxide Dismutase Mutant Gly85arg Length = 154 Back     alignment and structure
>pdb|1JK9|A Chain A, Heterodimer Between H48f-Ysod1 And Yccs Length = 153 Back     alignment and structure
>pdb|2JLP|A Chain A, Crystal Structure Of Human Extracellular Copper-Zinc Superoxide Dismutase. Length = 222 Back     alignment and structure
>pdb|1DO5|A Chain A, Human Copper Chaperone For Superoxide Dismutase Domain Ii Length = 154 Back     alignment and structure
>pdb|1B4T|A Chain A, H48c Yeast Cu(Ii)ZN SUPEROXIDE DISMUTASE ROOM TEMPERATURE (298k) Structure Length = 153 Back     alignment and structure
>pdb|1F1D|A Chain A, Crystal Structure Of Yeast H46c Cuznsod Mutant Length = 154 Back     alignment and structure
>pdb|4BCZ|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form. Length = 110 Back     alignment and structure
>pdb|4BD4|A Chain A, Monomeric Human Cu,zn Superoxide Dismutase, Loops Iv And Vii Deleted, Apo Form, Mutant H43f Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 2e-36
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 3e-36
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 8e-36
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 9e-36
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 1e-34
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 2e-34
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 2e-34
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 8e-34
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 2e-33
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 3e-33
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 5e-33
1do5_A154 Human copper chaperone for superoxide dismutase do 7e-33
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 4e-31
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 6e-31
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 3e-26
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 8e-26
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 3e-25
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 1e-24
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 5e-24
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 5e-24
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 2e-23
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 7e-20
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 2e-18
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 5e-18
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Length = 156 Back     alignment and structure
 Score =  122 bits (309), Expect = 2e-36
 Identities = 58/135 (42%), Positives = 72/135 (53%), Gaps = 17/135 (12%)

Query: 54  GDGGQTTVTGSFSGLKPGLHGFHVHALGNTTND-----PTLTVLDKNTVLQMMKNCHDCD 108
            D G   V   FSGLK G HGFHVH  G+TTN             +          H  D
Sbjct: 26  TDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAGAHFNPTKQEHGAPEDSIRHVGD 85

Query: 109 LGNANVRDD------VVDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSPSGGHELSKTT 162
           LGN     D        D  ISL+G +SIIGR++V+H + D+LG+      GGHELSK T
Sbjct: 86  LGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGR------GGHELSKVT 139

Query: 163 GNAGGRVACGIIGIQ 177
           GNAGGR+ACG++G+ 
Sbjct: 140 GNAGGRLACGVVGLA 154
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Length = 152 Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} PDB: 3l9e_A Length = 154 Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} PDB: 3kbf_A Length = 157 Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} PDB: 3f7k_A Length = 152 Back     alignment and structure
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 1srd_A Length = 154 Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Length = 156 Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Length = 153 Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Length = 154 Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Length = 150 Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Length = 168 Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Length = 154 Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Length = 222 Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Length = 208 Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Length = 154 Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Length = 151 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Length = 156 Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Length = 154 Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Length = 164 Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Length = 177 Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Length = 175 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Length = 140 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
3pu7_A154 Superoxide dismutase [CU-ZN], chloroplastic; oxido 100.0
4a7u_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, amyo 100.0
3f7l_A152 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
3l9y_A154 Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY 100.0
2q2l_A152 Superoxide dismutase; SOD, SAD, antioxidant, oxido 100.0
3kbe_A157 Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dis 100.0
1xso_A150 Copper,zinc superoxide dismutase; oxidoreductase ( 100.0
2wyt_A153 Superoxide dismutase [CU-ZN]; oxidoreductase, dise 100.0
1to4_A156 Superoxide dismutase; beta-barrel, oxidoreductase; 100.0
1f1g_A154 Cuznsod, copper-zinc superoxide dismutase; nitric 100.0
2e47_A156 EA4, TIME interVal measuring enzyme TIME; motallop 100.0
3ce1_A168 Superoxide dismutase [CU-ZN]; greek-KEY beta barre 100.0
1do5_A154 Human copper chaperone for superoxide dismutase do 100.0
1eqw_A156 Cu,Zn superoxide dismutase; greek KEY B-barrel, ox 100.0
2aqm_A154 Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10 100.0
1oal_A151 Superoxide dismutase; oxidoreductase, prokaryotic 100.0
2aqp_A164 Superoxide dismutase [CU-ZN]; electrostatic guidan 100.0
1eso_A154 SOD, Cu, Zn superoxide dismutase; oxidoreductase, 100.0
1xtm_B175 Hypothetical superoxide dismutase-like protein YO; 100.0
1z9n_A177 Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxid 100.0
2jlp_A222 Extracellular superoxide dismutase (Cu-Zn); glycol 100.0
1pzs_A208 Superoxide dismutase [CU-ZN]; Cu-protein, beta cor 100.0
1ej8_A140 Lys7; beta barrel, copper chaperone for SOD, domai 100.0
1qup_A222 Superoxide dismutase 1 copper chaperone; two domai 100.0
1jk9_B249 CCS, copper chaperone for superoxide dismutase; pr 99.98
>3pu7_A Superoxide dismutase [CU-ZN], chloroplastic; oxidoreductase, antioxidant, metal-binding, DIS bond, transit peptide; 1.80A {Solanum lycopersicum} PDB: 3km1_A 3km2_A 3mkg_A 3hog_A 3s0p_A 1srd_A Back     alignment and structure
Probab=100.00  E-value=2.5e-46  Score=295.84  Aligned_cols=128  Identities=50%  Similarity=0.763  Sum_probs=119.2

Q ss_pred             eeeEEEEEEcCCCcEEEEEEEeCCCCCceeeEEecCCCCCC-----CCccCCCCCCCCCCCCCCCCcccccceEeCCCC-
Q 047402           45 TNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHALGNTTN-----DPTLTVLDKNTVLQMMKNCHDCDLGNANVRDDV-  118 (178)
Q Consensus        45 ~~G~v~F~q~~~~~v~V~~~l~GL~pG~hg~HIHe~Gdcsa-----GgH~np~~~~hg~p~~~~~h~GDLgni~~~~~G-  118 (178)
                      ++|+|+|+|.+++.++|+++|+||+||+|+|||||+|||++     |+||||+++.|+.|.+..||+||||||+++++| 
T Consensus        15 V~G~v~f~q~~~g~v~v~~~i~GL~pG~hgfHIHe~Gd~s~gc~SaGgHfnP~~~~Hg~p~~~~~h~GDLgni~~~~~G~   94 (154)
T 3pu7_A           15 VEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPNKLTHGAPGDEIRHAGDLGNIVANADGV   94 (154)
T ss_dssp             CEEEEEEEEETTSCEEEEEEEESCCSEEEEEEEESCCCCTTGGGGGCSBCCTTCCCCCCTTCSSCCTTEEEEEEECTTSC
T ss_pred             CEEEEEEEEeCCCcEEEEEEEECCCCCcccEEEeecCCCCCCccccccccCCccCcCCCCCccCCcCCcccCEEeCCCCc
Confidence            47999999998667999999999999999999999999874     799999999999999889999999999999999 


Q ss_pred             -----ccceeeeCCCCCCcccEEEEecCCCCCCCCCCCCCCCCCCcccCCCCCceeeEEEEeecC
Q 047402          119 -----VDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSPSGGHELSKTTGNAGGRVACGIIGIQG  178 (178)
Q Consensus       119 -----~~~~i~L~g~~siiGRSiVIH~~~Dd~~~~~~~~~g~~~~s~~~G~aG~RiACgvI~~~~  178 (178)
                           ++++++|+++++|+|||||||+++|||++      |++|.|+++||||+|||||||+++.
T Consensus        95 a~~~~~d~~l~L~g~~~iiGRslVIH~~~DD~~~------g~~~~s~~tGnaG~RiaCGvIg~~~  153 (154)
T 3pu7_A           95 AEVTLVDNQIPLTGPNSVVGRALVVHELEDDLGK------GGHELSLTTGNAGGRLACGVVGLTP  153 (154)
T ss_dssp             EEEEEEESSCCSSSTTCCTTSEEEEESSCCCTTC------SCCTTTTTTTTCCCEEEEEECEECC
T ss_pred             EEEEEEeCCeeeCCCCccCCeEEEEECCCccCCC------CCCcCCcCCCCCcCcEEEEEEEEee
Confidence                 35667888899999999999999999998      9999999999999999999999873
>4a7u_A Superoxide dismutase [CU-ZN]; oxidoreductase, amyotrophic lateral sclerosis, antioxidant, mutation, metal-binding, Zn superoxide dismutase; HET: ALE; 0.98A {Homo sapiens} PDB: 3ecv_A 1uxl_A* 4a7g_F* 4a7q_A* 4a7t_A* 4a7s_A* 4a7v_A* 4b3e_A 4a7g_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A ... Back     alignment and structure
>3f7l_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor), greek KEY beta-barrel, amyloid filaments, ALS, FALS; 0.99A {Alvinella pompejana} SCOP: b.1.8.1 PDB: 3f7k_A Back     alignment and structure
>3l9y_A Cu-znsod1, superoxide dismutase [CU-ZN]; greek-KEY-barrel, antioxidant, copper, cytoplasm, metal- binding, oxidoreductase; 1.80A {Bombyx mori} SCOP: b.1.8.1 PDB: 3l9e_A Back     alignment and structure
>2q2l_A Superoxide dismutase; SOD, SAD, antioxidant, oxidoreductase, metal-binding; 2.37A {Potentilla atrosanguinea} Back     alignment and structure
>3kbe_A Superoxide dismutase [CU-ZN]; Cu-Zn superoxide dismutase, antioxidant, oxidoreductase, NEM disulfide bond, metal-binding; 1.10A {Caenorhabditis elegans} SCOP: b.1.8.1 PDB: 3kbf_A Back     alignment and structure
>1xso_A Copper,zinc superoxide dismutase; oxidoreductase (superoxide acceptor); 1.49A {Xenopus laevis} SCOP: b.1.8.1 Back     alignment and structure
>2wyt_A Superoxide dismutase [CU-ZN]; oxidoreductase, disease mutation, amyotrophic lateral sclero antioxidant; HET: SO4; 1.00A {Homo sapiens} PDB: 2wyz_A* 2wz0_A* 2wz5_A* 1hl4_A 1spd_A 2c9v_A* 1hl5_A 1pu0_A 2c9u_A 2c9s_A* 2v0a_A* 3ecu_A 3kh3_A 3kh4_A 3re0_A 2wko_A 3gzo_A 2wz6_A* 3gzp_A 1uxl_A ... Back     alignment and structure
>1to4_A Superoxide dismutase; beta-barrel, oxidoreductase; 1.55A {Schistosoma mansoni} SCOP: b.1.8.1 PDB: 1to5_A 3mnd_A Back     alignment and structure
>1f1g_A Cuznsod, copper-zinc superoxide dismutase; nitric oxide, oxidoreductase; 1.35A {Saccharomyces cerevisiae} SCOP: b.1.8.1 PDB: 1f1a_A 1f18_A 1jcv_A 1b4l_A 1sdy_A 1yaz_A 1yso_A 2jcw_A 1f1d_A 1jk9_A 1b4t_A Back     alignment and structure
>2e47_A EA4, TIME interVal measuring enzyme TIME; motalloprotein, glycoprotein, metal binding protein; HET: NAG MAN; 2.11A {Bombyx mori} PDB: 2e46_A Back     alignment and structure
>3ce1_A Superoxide dismutase [CU-ZN]; greek-KEY beta barrel, antioxidant, copper, metal-binding, oxidoreductase, zinc; 1.20A {Cryptococcus liquefaciens} Back     alignment and structure
>1do5_A Human copper chaperone for superoxide dismutase domain II; beta-barrel; 2.75A {Homo sapiens} SCOP: b.1.8.1 Back     alignment and structure
>1eqw_A Cu,Zn superoxide dismutase; greek KEY B-barrel, oxidoreductase; 2.30A {Salmonella typhimurium} SCOP: b.1.8.1 PDB: 2wn0_A* 2wn1_A* 2wwn_A* 2wwo_A* Back     alignment and structure
>2aqm_A Superoxide dismutase [CU-ZN]; oxidoreductase; 1.10A {Brucella abortus} Back     alignment and structure
>1oal_A Superoxide dismutase; oxidoreductase, prokaryotic Cu, protein-subunit interaction recognition, protein electrostatic; 1.5A {Photobacterium leiognathi} SCOP: b.1.8.1 PDB: 1bzo_A 1ibh_A 1ibd_A 1yai_A 1ib5_A 1oaj_A 1ibb_A 1ibf_A Back     alignment and structure
>2aqp_A Superoxide dismutase [CU-ZN]; electrostatic guidance, neisseria MENI oxidoreductase; 1.30A {Neisseria meningitidis} PDB: 2aqn_A 2aqr_A 2aqq_A 2aqt_C 2aqs_A 2aps_A 1z9p_A Back     alignment and structure
>1eso_A SOD, Cu, Zn superoxide dismutase; oxidoreductase, monomeric superoxide dismutase, copper enzymes, enzyme evolution, X- RAY; 2.00A {Escherichia coli} SCOP: b.1.8.1 PDB: 2k4w_A Back     alignment and structure
>1xtm_B Hypothetical superoxide dismutase-like protein YO; SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, STRU genomics, unknown function; 1.60A {Bacillus subtilis} PDB: 1xtl_B 1s4i_B 1u3n_A Back     alignment and structure
>1z9n_A Superoxide dismutase [CU-ZN]; Cu-Zn SOD, SOD, oxidoreductase; HET: HEM; 1.50A {Haemophilus ducreyi} Back     alignment and structure
>2jlp_A Extracellular superoxide dismutase (Cu-Zn); glycolisation, oxidoreductase, heparin binding, heparin-BIND oxidative stress, antioxidant; 1.70A {Homo sapiens} Back     alignment and structure
>1pzs_A Superoxide dismutase [CU-ZN]; Cu-protein, beta core, antioxidant, metal binding, greek KEY barrel, oxidoreductase; 1.63A {Mycobacterium tuberculosis} SCOP: b.1.8.1 Back     alignment and structure
>1ej8_A Lys7; beta barrel, copper chaperone for SOD, domain 2; 1.55A {Saccharomyces cerevisiae} SCOP: b.1.8.1 Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d1to4a_156 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bloo 1e-28
d2c9va1153 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD 6e-28
d1srda_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spin 3e-26
d1f1ga_153 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Bake 1e-25
d1xsoa_150 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Afri 1e-25
d1do5a_154 b.1.8.1 (A:) Copper chaperone for superoxide dismu 1e-23
d1pzsa_171 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Myco 2e-23
d2apsa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Acti 8e-20
d1esoa_154 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Esch 9e-20
d1oala_151 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Phot 3e-19
d1eqwa_155 b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salm 4e-19
d1ej8a_140 b.1.8.1 (A:) Copper chaperone for superoxide dismu 2e-12
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 156 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Blood fluke (Schistosoma mansoni) [TaxId: 6183]

 Score =  102 bits (254), Expect = 1e-28
 Identities = 59/134 (44%), Positives = 73/134 (54%), Gaps = 17/134 (12%)

Query: 54  GDGGQTTVTGSFSGLKPGLHGFHVHALGNTTNDPT-----LTVLDKNTVLQMMKNCHDCD 108
            D G   V   FSGLK G HGFHVH  G+TTN  T          +          H  D
Sbjct: 26  TDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAGAHFNPTKQEHGAPEDSIRHVGD 85

Query: 109 LGNANVRDD------VVDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSPSGGHELSKTT 162
           LGN     D        D  ISL+G +SIIGR++V+H + D+LG+      GGHELSK T
Sbjct: 86  LGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGR------GGHELSKVT 139

Query: 163 GNAGGRVACGIIGI 176
           GNAGGR+ACG++G+
Sbjct: 140 GNAGGRLACGVVGL 153
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 154 Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 150 Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Length = 155 Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Length = 154 Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Length = 151 Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Length = 155 Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d1srda_154 Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia 100.0
d1to4a_156 Cu,Zn superoxide dismutase, SOD {Blood fluke (Schi 100.0
d2c9va1153 Cu,Zn superoxide dismutase, SOD {Human (Homo sapie 100.0
d1xsoa_150 Cu,Zn superoxide dismutase, SOD {African clawed fr 100.0
d1f1ga_153 Cu,Zn superoxide dismutase, SOD {Baker's yeast (Sa 100.0
d1do5a_154 Copper chaperone for superoxide dismutase, C-termi 100.0
d1eqwa_155 Cu,Zn superoxide dismutase, SOD {Salmonella typhim 100.0
d2apsa_155 Cu,Zn superoxide dismutase, SOD {Actinobacillus pl 100.0
d1oala_151 Cu,Zn superoxide dismutase, SOD {Photobacterium le 100.0
d1esoa_154 Cu,Zn superoxide dismutase, SOD {Escherichia coli 100.0
d1pzsa_171 Cu,Zn superoxide dismutase, SOD {Mycobacterium tub 100.0
d1ej8a_140 Copper chaperone for superoxide dismutase, C-termi 99.98
>d1srda_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cu,Zn superoxide dismutase-like
family: Cu,Zn superoxide dismutase-like
domain: Cu,Zn superoxide dismutase, SOD
species: Spinach (Spinacia oleracea) [TaxId: 3562]

Probab=100.00  E-value=6.5e-45  Score=285.55  Aligned_cols=128  Identities=52%  Similarity=0.795  Sum_probs=119.0

Q ss_pred             eeeEEEEEEcCCCcEEEEEEEeCCCCCceeeEEecCCCCCC-----CCccCCCCCCCCCCCCCCCCcccccceEeCCCC-
Q 047402           45 TNRSDDLIMGDGGQTTVTGSFSGLKPGLHGFHVHALGNTTN-----DPTLTVLDKNTVLQMMKNCHDCDLGNANVRDDV-  118 (178)
Q Consensus        45 ~~G~v~F~q~~~~~v~V~~~l~GL~pG~hg~HIHe~Gdcsa-----GgH~np~~~~hg~p~~~~~h~GDLgni~~~~~G-  118 (178)
                      ++|+|+|+|.+++.|+|+++|+||+||+|+|||||+|||++     |+||||.+..|+.|....+|.||||||+++++| 
T Consensus        15 v~G~v~f~q~~~g~v~v~v~l~GL~pG~hg~HIHe~Gd~~~~~~saGgh~np~~~~hg~~~~~~~h~GDLgni~~~~~G~   94 (154)
T d1srda_          15 VEGVVTLTQEDDGPTTVNVRISGLAPGKHGFHLHEFGDTTNGCMSTGPHFNPDKKTHGAPEDEVRHAGDLGNIVANTDGV   94 (154)
T ss_dssp             CCCEEEEEEETTSCEEEEEEEESCCSEECCEEEESCCCCTTGGGGGCSBCCTTCCCCCCSSCSSCCSSBCCCCEECTTSE
T ss_pred             cEEEEEEEECCCCcEEEEEEEecCCCCceeEEEecCCccCCCccccccccccccccccCCCccccccccccCeEECCCCe
Confidence            46999999998777999999999999999999999999974     699999999999999889999999999999999 


Q ss_pred             -----ccceeeeCCCCCCcccEEEEecCCCCCCCCCCCCCCCCCCcccCCCCCceeeEEEEeecC
Q 047402          119 -----VDNQISLSGPNSIIGRAVVVHSDPDNLGKECSSPSGGHELSKTTGNAGGRVACGIIGIQG  178 (178)
Q Consensus       119 -----~~~~i~L~g~~siiGRSiVIH~~~Dd~~~~~~~~~g~~~~s~~~G~aG~RiACgvI~~~~  178 (178)
                           ++..++|+++++|+|||||||+++|||+.      +++++|+++|+||+|||||||+++.
T Consensus        95 ~~~~~~~~~l~L~g~~~iiGRSivIH~~~Dd~~~------~~~~~s~~~g~aG~RiACgvI~~~~  153 (154)
T d1srda_          95 AEATIVDNQIPLTGPNSVVGRALVVHELEDDLGK------GGHELSPTTGNAGGRLACGVVGLTP  153 (154)
T ss_dssp             EEEEEEESSCCSSSTTCCTTCEEEEESSCCCTTC------SCSSSTTTTCSCCCEEEEEECEEEC
T ss_pred             EEEEEEeCcEEeCCCCCCCCcEEEEecCCcccCC------CCcccCcccCCCCceEEEEEEEeec
Confidence                 34567888999999999999999999987      8999999999999999999999874
>d1to4a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d2c9va1 b.1.8.1 (A:1-153) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xsoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1f1ga_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1do5a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqwa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2apsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Actinobacillus pleuropneumoniae [TaxId: 715]} Back     information, alignment and structure
>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]} Back     information, alignment and structure
>d1esoa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzsa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure