Citrus Sinensis ID: 047424

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38

MVGFRQYVAVLLVLSAPFCLGIRSIPSRSIDGGDFLGFDRFTEAPDYRNGRGCPVSANKITSSCDPSLVHVAMTLDSEYLRGSIAAVHSALKHASCPENIFFHFISAEFDSASPRVLTQLVRSTFPSLNFKVYIFREDTVINLISSSIREALENPLNYARNYLGDILDPCVDRVIYIDSDLVLVDDIHKLWDITLTKSKIIGAPEYCHANFTKYFTDNFWSDPLLSRVFGSRKPCYFNTGVMVMDLVRWRKGNYRKRIENWMEIQRRKRIYDLGSLPPFLLVFAGNVEAIDHRWNQHGLGGDNVKGSCRSLHPGPVSLLHWSGKGKPWVRLDNKQPCPLDYLWEPYDLFKHSNRIKDHHQSSVLFPPSSSSLIGFSSFL

ccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHcccccccEEEEEEccccHHHcccccccccccccHHHHHHHHccccccccccEEEEECccEEEEcccHHHHcccccccCEEEEEEEccccccccccccccccHHHHHHcccccccccccccHHccHHHHHHHcHHHHHHHHHHHHccccccccccccHHHHHHcccEECcccccccccccccccccccccccccccEEEEEccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccc

*VGFRQYVAVLLVLSAPFCLGIRSIPSRSIDGGDFLGFDRFTEAPDYRNGRGCPVSANKITSSCDPSLVHVAMTLDSEYLRGSIAAVHSALKHASCPENIFFHFISAEFDSASPRVLTQLVRSTFPSLNFKVYIFREDTVINLISSSIREALENPLNYARNYLGDILDPCVDRVIYIDSDLVLVDDIHKLWDITLTKSKIIGAPEYCHANFTKYFTDNFWSDPLLSRVFGSRKPCYFNTGVMVMDLVRWRKGNYRKRIENWMEIQRRKRIYDLGSLPPFLLVFAGNVEAIDHRWNQHGLGGDNVKGSCRSLHPGPVSLLHWSGKGKPWVRLDNKQPCPLDYLWEPYDLFKHSNR******************IGFSSFL

xxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable galacturonosyltransferase-like 9	May be involved in pectin and/or xylans biosynthesis in cell walls.	confident	O04536
Probable galacturonosyltransferase-like 8	May be involved in pectin and/or xylans biosynthesis in cell walls.	probable	O48684

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G9R, chain A
Confidence level:very confident
Coverage over the Query: 70-212,223-348
View the alignment between query and template
View the model in PyMOL

Template: 1XHB, chain A
Confidence level:probable
Coverage over the Query: 41-143,157-192
View the alignment between query and template
View the model in PyMOL