Citrus Sinensis ID: 047474


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320------
MSINSQNDEGSSTSTPQMSVEEKFRLVRSIGEECIQEDELLNLLTKKPQPICYDGFEPSGRMHIAQGVMKAISVNKLTSAGCKVKIWVADWFAQLNNKMGGDLKKIQTVGRYLIEIWIAVGMRTERVEFLWSSEEINARADEYWPLVMDIARRNKLPRIMRCCQIMGRSEQDELTAAQILYPCMQCADIFFLKADICQLGMDQRKVNVLAREYCDDIKRKNKPIILSHHMLPGLQQGQEKMSKSDPSSAIYMEDEEAEVNVKIKKAYCPPKIVEGNPCLEYIKYIIFPWDKKFVVERSEANGGNKTFETMKNLLLIMKKEIYILGT
cccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHcccccEEEEECcccccccHHHHHHHHHHHHHHHHcccEEEEEEEEHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccEEEEccHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccEEEEEHHcccccccEEEEECcccccccccccHHHHHHHHHHHcccccc
***********************FRLVRSIGEECIQEDELLNLLTKKPQPICYDGFEPSGRMHIAQGVMKAISVNKLTSAGCKVKIWVADWFAQLNNKMGGDLKKIQTVGRYLIEIWIAVGMRTERVEFLWSSEEINARADEYWPLVMDIARRNKLPRIMRCCQIMGRSEQDELTAAQILYPCMQCADIFFLKADICQLGMDQRKVNVLAREYCDDIKRKNKPIILSHHM*********************MEDEEAEVNVKIKKAYCPPKIVEGNPCLEYIKYIIFPWDKKFVVERSEANGGNKTFETMKNLLLIMKKEIYIL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSINSQNDEGSSTSTPQMSVEEKFRLVRSIGEECIQEDELLNLLTKKPQPICYDGFEPSGRMHIAQGVMKAISVNKLTSAGCKVKIWVADWFAQLNNKMGGDLKKIQTVGRYLIEIWIAVGMRTERVEFLWSSEEINARADEYWPLVMDIARRNKLPRIMRCCQIMGRSEQDELTAAQILYPCMQCADIFFLKADICQLGMDQRKVNVLAREYCDDIKRKNKPIILSHHMLPGLQQGQEKMSKSDPSSAIYMEDEEAEVNVKIKKAYCPPKIVEGNPCLEYIKYIIFPWDKKFVVERSEANGGNKTFETMKNLLLIMKKEIYILGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tyrosine--tRNA ligase Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).probableQ46BQ5
Tyrosine--tRNA ligase Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).probableQ6L2J1
Tyrosine--tRNA ligase Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).probableQ57834

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.1.-.-1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.probable
6.1.1.-Ligases forming aminoacyl-tRNA and related compounds.probable
6.1.1.1Tyrosine--tRNA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P0J, chain A
Confidence level:very confident
Coverage over the Query: 16-321
View the alignment between query and template
View the model in PyMOL