Citrus Sinensis ID: 047493

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MILTELFNQKRKKNGRWWLLPNDGSSAVGADAQLIIPIESAHCTISYLGGLGLFQFKDLNAGKSLFQRTFAAQVRFM
cHHHHHHHHHccccccEEEcccccccccccEEEEEccccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHcc
MILTE****K***NGRWWLLPNDGSSAVGADAQLIIPIESAHCTISYLGGLGLFQFKDLNAGKSLFQRTFAAQVRFM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILTELFNQKRKKNGRWWLLPNDGSSAVGADAQLIIPIESAHCTISYLGGLGLFQFKDLNAGKSLFQRTFAAQVRFM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar proton ATPase a3 Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes. Required for assembly and activity of the V-ATPase. Involved in vacuolar nutrient storage (e.g. accumulation and storage of nitrate) and in tolerance to some toxic ions (e.g. zinc ions sequestration in vacuoles).probableQ8W4S4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RRK, chain A
Confidence level:confident
Coverage over the Query: 29-76
View the alignment between query and template
View the model in PyMOL