Citrus Sinensis ID: 047524

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
YAGDSQFGRKNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNWIGYIAVACDEGKAALGRRDILTAWLRNEQVLDEVERLLGVYDAEDEEASKTITSHTIGPVIAVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYPLLGSKGGFKLEVKQDIALVNKRMDVLKEDYLVPGKWLCLENTGMVQGEDGNWKLEDHEIEDGDGI
ccccccccHHcHHHHcccccccccccEEEEEEEEEccccccHHHHHcccccccccccccccccEEEEccccccEEcccccEEEEEHHHHHHHHHHHHHHHccccccccEEEEEEccccccEEEEEEEEcccccccHHHHHHHHcccccEEEEEEEcccccccccccccccccEEEcccEEEEEcccccccccccccccccEEEccccEEEccccccccccccccccccc
ccccccccHHHHHHHHcccccccccEEEEEEEEEccccccccHHccccccHHHccccccEEEEEEEEccHHHHHccccEEEEEEcccccHHHHHHHHHHHHccccccEEEEEEcccccccccEEEEEEcccccccHHHHHHHHHccccEEEEEEEccccccccccccccccEEEEEcEEEEEEcccccccccccccccccEEEcccccEEcccccEEcccccccccccc
yagdsqfgrknffsrvglykgnpfkyEVTKFLYatsssplpaaFIFKSLSsecwhkesnwiGYIAVACDEGKAALGRRDILTAWLRNEQVLDEVERLLGvydaedeeasktitshtigPVIAVTVFsfgspyvgdiEFKKLCDSMEHLHMLRVRNlqdqipsypllgskggfklEVKQDIALVNKRMDVlkedylvpgkwlclentgmvqgedgnwkledheiedgdgi
yagdsqfgrknffsrvglykgnPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNWIGYIAVACDEGKAALGRRDILTAWLRNEQVLDEVERLLGVYDAEDEEAsktitshtigpVIAVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYPLLGSKGGFKLEVKQDIALVNKRMDVLKEDYLVPGKWLCLENTgmvqgedgnwkledheiedgdgi
YAGDSQFGRKNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNWIGYIAVACDEGKAALGRRDILTAWLRNEQVLDEVERLLGVYDAEDEEASKTITSHTIGPVIAVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYPLLGSKGGFKLEVKQDIALVNKRMDVLKEDYLVPGKWLCLENTGMVQGEDGNWKLEDHEIEDGDGI
*********KNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNWIGYIAVACDEGKAALGRRDILTAWLRNEQVLDEVERLLGVYDAEDEEASKTITSHTIGPVIAVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYPLLGSKGGFKLEVKQDIALVNKRMDVLKEDYLVPGKWLCLENTGMVQGED**W*************
YAGDSQFGRKNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNWIGYIAVACDEGKAALGRRDILTAWLRNEQVLDEVERLLGVYDAEDEEASKTITSHTIGPVIAVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYPLLGSKGGFKLEVKQDIALVNKRMDVLKEDYLVPGKWLCLENTGMVQGEDGNWK************
YAGDSQFGRKNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNWIGYIAVACDEGKAALGRRDILTAWLRNEQVLDEVERLLGVYDAEDEEASKTITSHTIGPVIAVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYPLLGSKGGFKLEVKQDIALVNKRMDVLKEDYLVPGKWLCLENTGMVQGEDGNWKLEDH********
YAGDSQFGRKNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNWIGYIAVACDEGKAALGRRDILTAWLRNEQVLDEVERLLGVYDAEDEEASKTITSHTIGPVIAVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYPLLGSKGGFKLEVKQDIALVNKRMDVLKEDYLVPGKWLCLENTGMVQGEDGNWKLED*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YAGDSQFGRKNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNWIGYIAVACDEGKAALGRRDILTAWLRNEQVLDEVERLLGVYDAEDEEASKTITSHTIGPVIAVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYPLLGSKGGFKLEVKQDIALVNKRMDVLKEDYLVPGKWLCLENTGMVQGEDGNWKLEDHEIEDGDGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query229 2.2.26 [Sep-21-2011]
O82274414 Phospholipase A1-IIbeta O yes no 0.951 0.526 0.364 1e-50
Q9LNC2423 Phospholipase A1-IIalpha yes no 0.943 0.510 0.347 3e-47
A2ZW16393 Phospholipase A1-II 1 OS= yes no 0.973 0.567 0.342 6e-45
A2WT95393 Phospholipase A1-II 1 OS= N/A no 0.973 0.567 0.342 6e-45
O49523419 Phospholipase A1-IIgamma no no 0.991 0.541 0.344 2e-44
B9EYD3396 Phospholipase A1-II 4 OS= yes no 0.943 0.545 0.307 3e-35
Q6F358411 Phospholipase A1-II 6 OS= yes no 0.973 0.542 0.321 2e-34
A2WT96403 Phospholipase A1-II 2 OS= N/A no 0.956 0.543 0.285 2e-30
Q0JKT4408 Phospholipase A1-II 2 OS= no no 0.956 0.536 0.282 8e-30
Q6F357407 Phospholipase A1-II 7 OS= no no 0.851 0.479 0.308 1e-27
>sp|O82274|PLA19_ARATH Phospholipase A1-IIbeta OS=Arabidopsis thaliana GN=At2g31100 PE=1 SV=2 Back     alignment and function desciption
 Score =  199 bits (506), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 160/337 (47%), Gaps = 119/337 (35%)

Query: 1   YAGDSQFGRKNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNW 60
           Y GDS + ++  F+R G  K NPF+YEVTK++Y TSS  LP  FI KSLS E W+KESNW
Sbjct: 55  YVGDSCYTKEELFARTGYLKANPFRYEVTKYIYGTSSIRLPECFIIKSLSREAWNKESNW 114

Query: 61  IGYIAVACDEGKAALGRRDILTAWLRNEQVLDEVERL----------------------- 97
           +GYIAVA DEGK  LGRR I+ AW    Q+ +                            
Sbjct: 115 LGYIAVATDEGKKLLGRRGIVVAWRGTIQLYEWANDFDFPLESAVMVFPGANPNDEPRVA 174

Query: 98  ---LGVYDAED---------------------------EEASKTITSHTIGPVIA----- 122
              L +Y + D                           E+ + T+T H++G V++     
Sbjct: 175 NGWLSLYTSTDPRSRFDKTSAQEQVQEELKRLLELYKNEDVTITLTGHSLGAVMSILSAA 234

Query: 123 -------------------VTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSY 163
                              VTVF+FGSP +GD  FK+L +S+EHLH+LRV N+ D IP Y
Sbjct: 235 DFLHNEWPKITPSLQHSLCVTVFAFGSPQIGDRSFKRLVESLEHLHILRVTNVPDLIPRY 294

Query: 164 PL-------------------------LG-----------------SKGGFKLEVKQDIA 181
           P+                         LG                 ++G FKLE+ +DIA
Sbjct: 295 PVFRFTDIGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGVAGTQHNQGEFKLEINRDIA 354

Query: 182 LVNKRMDVLKEDYLVPGKWLCLENTGMVQGEDGNWKL 218
           LVNK +D L++ YLVPG W  LEN GMVQ +DG WKL
Sbjct: 355 LVNKGLDALEDKYLVPGHWWVLENKGMVQSDDGTWKL 391
Acylhydrolase that catalyzes the hydrolysis of phospholipids at the sn-1 position.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9LNC2|PLA18_ARATH Phospholipase A1-IIalpha OS=Arabidopsis thaliana GN=At1g06250 PE=2 SV=1 Back     alignment and function description
>sp|A2ZW16|PLA1_ORYSJ Phospholipase A1-II 1 OS=Oryza sativa subsp. japonica GN=Os01g0651100 PE=2 SV=2 Back     alignment and function description
>sp|A2WT95|PLA1_ORYSI Phospholipase A1-II 1 OS=Oryza sativa subsp. indica GN=OsI_03083 PE=3 SV=2 Back     alignment and function description
>sp|O49523|DSEL_ARATH Phospholipase A1-IIgamma OS=Arabidopsis thaliana GN=DSEL PE=1 SV=1 Back     alignment and function description
>sp|B9EYD3|PLA4_ORYSJ Phospholipase A1-II 4 OS=Oryza sativa subsp. japonica GN=Os01g0652300 PE=2 SV=2 Back     alignment and function description
>sp|Q6F358|PLA6_ORYSJ Phospholipase A1-II 6 OS=Oryza sativa subsp. japonica GN=Os05g0574000 PE=2 SV=1 Back     alignment and function description
>sp|A2WT96|PLA2_ORYSI Phospholipase A1-II 2 OS=Oryza sativa subsp. indica GN=OsI_03084 PE=2 SV=2 Back     alignment and function description
>sp|Q0JKT4|PLA2_ORYSJ Phospholipase A1-II 2 OS=Oryza sativa subsp. japonica GN=Os01g0651200 PE=2 SV=1 Back     alignment and function description
>sp|Q6F357|PLA7_ORYSJ Phospholipase A1-II 7 OS=Oryza sativa subsp. japonica GN=Os05g0574100 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
449444701 398 PREDICTED: phospholipase A1-IIgamma-like 0.973 0.560 0.393 1e-56
356557730 423 PREDICTED: phospholipase A1-IIgamma-like 0.973 0.527 0.390 2e-54
225443837 391 PREDICTED: phospholipase A1-IIgamma [Vit 0.982 0.575 0.385 1e-52
255563100 422 triacylglycerol lipase, putative [Ricinu 0.978 0.530 0.383 6e-52
449434290 437 PREDICTED: phospholipase A1-IIgamma-like 0.969 0.508 0.358 5e-51
356546593 421 PREDICTED: phospholipase A1-IIgamma-like 0.973 0.529 0.373 2e-50
224114706 414 predicted protein [Populus trichocarpa] 0.969 0.536 0.375 9e-50
224079103 395 predicted protein [Populus trichocarpa] 0.986 0.572 0.381 6e-49
334350869 414 RecName: Full=Phospholipase A1-IIbeta 0.951 0.526 0.364 7e-49
357446943 414 Lipase [Medicago truncatula] gi|35548279 0.969 0.536 0.375 2e-48
>gi|449444701|ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus] gi|449516319|ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 167/343 (48%), Gaps = 120/343 (34%)

Query: 1   YAGDSQFGRKNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNW 60
           +AGDS F RKN FSRVGL   NP+KY +TKFLYATS   +  AF+ +SLS E W+KESNW
Sbjct: 55  FAGDSHFSRKNLFSRVGLAIANPYKYNITKFLYATSGIEVSEAFLLRSLSREAWNKESNW 114

Query: 61  IGYIAVACDEGKAALGRRDILTAWLRNEQVLD---------------------------- 92
           IGYIAVA DEGKAALGRRDI+ AW    Q L+                            
Sbjct: 115 IGYIAVATDEGKAALGRRDIVIAWRGTIQALEWVNDFEFPLVPADKLFGASNDSKVHKGW 174

Query: 93  ------------------------EVERLLGVYDAEDEEASKTITSHTIGPVIA------ 122
                                   E+E+LL  +  +DE+ S TIT H++G  +       
Sbjct: 175 LSIYTSQDARSPFNTNSARQQVLSEIEKLLEEF--QDEDISITITGHSLGAALGTLNATD 232

Query: 123 ------------------VTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYP 164
                             VTVF FGSP+VGD  F+K  +SM  LH+LR RN  D +P YP
Sbjct: 233 IIANQINRGKKQPQKPCPVTVFLFGSPHVGDRNFRKTFNSMNELHLLRTRNKADIVPDYP 292

Query: 165 LL------------------------------------------GSKGGFKLEVKQDIAL 182
           L                                           G++GGF LEVK+DIA 
Sbjct: 293 LTGYAKVGEELIIDTRKSEYLKSPGGFKSWHSLEAYLHGVAGTQGNEGGFTLEVKRDIAR 352

Query: 183 VNKRMDVLKEDYLVPGKWLCLENTGMVQGEDGNWKLEDHEIED 225
           VNK ++ LKE+YLVP  W C +N GMVQ  DG WKL+DHE ++
Sbjct: 353 VNKALNALKEEYLVPESWWCAQNKGMVQDADGFWKLDDHETDE 395

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356557730|ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max] Back     alignment and taxonomy information
>gi|225443837|ref|XP_002266982.1| PREDICTED: phospholipase A1-IIgamma [Vitis vinifera] Back     alignment and taxonomy information
>gi|255563100|ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis] gi|223538245|gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449434290|ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus] gi|449479539|ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356546593|ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max] Back     alignment and taxonomy information
>gi|224114706|ref|XP_002316835.1| predicted protein [Populus trichocarpa] gi|222859900|gb|EEE97447.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224079103|ref|XP_002305750.1| predicted protein [Populus trichocarpa] gi|222848714|gb|EEE86261.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|334350869|sp|O82274.2|PLA19_ARATH RecName: Full=Phospholipase A1-IIbeta Back     alignment and taxonomy information
>gi|357446943|ref|XP_003593747.1| Lipase [Medicago truncatula] gi|355482795|gb|AES63998.1| Lipase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
TAIR|locus:2055884 414 AT2G31100 [Arabidopsis thalian 0.366 0.202 0.619 3.9e-57
TAIR|locus:2124529 419 DSEL "DAD1-like seeding establ 0.414 0.226 0.510 1.1e-55
TAIR|locus:2038505 423 AT1G06250 [Arabidopsis thalian 0.366 0.198 0.547 6.3e-46
UNIPROTKB|Q6F358 411 LOC_Os05g49830 "Phospholipase 0.410 0.228 0.484 2.4e-45
UNIPROTKB|A2WT95 393 OsI_03083 "Phospholipase A1-II 0.406 0.236 0.479 1.3e-38
UNIPROTKB|A2ZW16 393 LOC_Os01g46240 "Phospholipase 0.406 0.236 0.479 1.3e-38
UNIPROTKB|A2WT96 403 OsI_03084 "Phospholipase A1-II 0.410 0.233 0.395 1.9e-36
UNIPROTKB|Q0JKT4 408 LOC_Os01g46250 "Phospholipase 0.410 0.230 0.385 7.9e-36
UNIPROTKB|B9EYD3396 LOC_Os01g46370 "Phospholipase 0.257 0.148 0.576 4.9e-35
UNIPROTKB|Q8RZ40 420 LOC_Os01g46290 "Phospholipase 0.393 0.214 0.414 1.9e-32
TAIR|locus:2055884 AT2G31100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 286 (105.7 bits), Expect = 3.9e-57, Sum P(3) = 3.9e-57
 Identities = 52/84 (61%), Positives = 62/84 (73%)

Query:     1 YAGDSQFGRKNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNW 60
             Y GDS + ++  F+R G  K NPF+YEVTK++Y TSS  LP  FI KSLS E W+KESNW
Sbjct:    55 YVGDSCYTKEELFARTGYLKANPFRYEVTKYIYGTSSIRLPECFIIKSLSREAWNKESNW 114

Query:    61 IGYIAVACDEGKAALGRRDILTAW 84
             +GYIAVA DEGK  LGRR I+ AW
Sbjct:   115 LGYIAVATDEGKKLLGRRGIVVAW 138
GO:0004806 "triglyceride lipase activity" evidence=IEA;ISS
GO:0006629 "lipid metabolic process" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
TAIR|locus:2124529 DSEL "DAD1-like seeding establishment-related lipase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038505 AT1G06250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6F358 LOC_Os05g49830 "Phospholipase A1-II 6" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A2WT95 OsI_03083 "Phospholipase A1-II 1" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
UNIPROTKB|A2ZW16 LOC_Os01g46240 "Phospholipase A1-II 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A2WT96 OsI_03084 "Phospholipase A1-II 2" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
UNIPROTKB|Q0JKT4 LOC_Os01g46250 "Phospholipase A1-II 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|B9EYD3 LOC_Os01g46370 "Phospholipase A1-II 4" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8RZ40 LOC_Os01g46290 "Phospholipase A1-II 3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00035897001
SubName- Full=Chromosome chr10 scaffold_81, whole genome shotgun sequence; (391 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
PLN02571413 PLN02571, PLN02571, triacylglycerol lipase 9e-82
PLN02324415 PLN02324, PLN02324, triacylglycerol lipase 8e-70
PLN02454 414 PLN02454, PLN02454, triacylglycerol lipase 7e-26
PLN02310405 PLN02310, PLN02310, triacylglycerol lipase 9e-26
PLN02761527 PLN02761, PLN02761, lipase class 3 family protein 1e-25
PLN02454414 PLN02454, PLN02454, triacylglycerol lipase 1e-24
PLN03037525 PLN03037, PLN03037, lipase class 3 family protein; 2e-24
PLN02753531 PLN02753, PLN02753, triacylglycerol lipase 1e-23
PLN02719518 PLN02719, PLN02719, triacylglycerol lipase 4e-21
PLN02802509 PLN02802, PLN02802, triacylglycerol lipase 3e-20
PLN02408365 PLN02408, PLN02408, phospholipase A1 2e-16
PLN02761527 PLN02761, PLN02761, lipase class 3 family protein 1e-09
pfam01764141 pfam01764, Lipase_3, Lipase (class 3) 5e-09
cd00519229 cd00519, Lipase_3, Lipase (class 3) 9e-07
PLN02719518 PLN02719, PLN02719, triacylglycerol lipase 2e-05
PLN03037525 PLN03037, PLN03037, lipase class 3 family protein; 1e-04
PLN02310405 PLN02310, PLN02310, triacylglycerol lipase 3e-04
PLN02753531 PLN02753, PLN02753, triacylglycerol lipase 5e-04
>gnl|CDD|215309 PLN02571, PLN02571, triacylglycerol lipase Back     alignment and domain information 
 Score =  249 bits (638), Expect = 9e-82
 Identities = 139/346 (40%), Positives = 175/346 (50%), Gaps = 121/346 (34%)

Query: 1   YAGDSQFGRKNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNW 60
           +AG S + +K+FF++VGL KGNP+KY+VTKFLYATS   +P AFI KSLS E W KESNW
Sbjct: 68  FAGSSLYAKKDFFAKVGLEKGNPYKYKVTKFLYATSQIHVPEAFILKSLSREAWSKESNW 127

Query: 61  IGYIAVACDEGKAALGRRDILTA---------WLRN------------------------ 87
           +GY+AVA DEGKA LGRRDI+ A         W+ +                        
Sbjct: 128 MGYVAVATDEGKALLGRRDIVIAWRGTVQTLEWVNDFEFNLVSASKIFGESNDQPKVHQG 187

Query: 88  --------------------EQVLDEVERLLGVYDAEDEEASKTITSHTIGPVIA----- 122
                               +QVL+EV RL+  Y  +DEE S TI  H++G  +A     
Sbjct: 188 WYSIYTSDDERSPFNKTSARDQVLNEVGRLVEKY--KDEEISITICGHSLGAALATLNAV 245

Query: 123 -------------------VTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSY 163
                              VT F F SP VGD +FKKL   ++ L +LRVRNL D IP+Y
Sbjct: 246 DIVANGFNRSKSRPNKSCPVTAFVFASPRVGDSDFKKLFSGLKDLRVLRVRNLPDVIPNY 305

Query: 164 PLLG------------------------------------------SKGGFKLEVKQDIA 181
           PL+G                                          SKGGF+LEV +DIA
Sbjct: 306 PLIGYSDVGEELPIDTRKSKYLKSPGNLSTWHNLEAYLHGVAGTQGSKGGFRLEVNRDIA 365

Query: 182 LVNKRMDVLKEDYLVPGKWLCLENTGMVQGEDGNWKLEDHEIEDGD 227
           LVNK +D LK++YLVPG W   +N GMVQ  DG+WKL DHE +D +
Sbjct: 366 LVNKSVDGLKDEYLVPGSWRVQKNKGMVQQADGSWKLMDHEEDDNE 411

Length = 413
>gnl|CDD|177958 PLN02324, PLN02324, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|215249 PLN02454, PLN02454, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|215176 PLN02310, PLN02310, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|215406 PLN02761, PLN02761, lipase class 3 family protein Back     alignment and domain information
>gnl|CDD|215249 PLN02454, PLN02454, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|215547 PLN03037, PLN03037, lipase class 3 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178354 PLN02753, PLN02753, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|178321 PLN02719, PLN02719, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|215432 PLN02802, PLN02802, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|215228 PLN02408, PLN02408, phospholipase A1 Back     alignment and domain information
>gnl|CDD|215406 PLN02761, PLN02761, lipase class 3 family protein Back     alignment and domain information
>gnl|CDD|216688 pfam01764, Lipase_3, Lipase (class 3) Back     alignment and domain information
>gnl|CDD|238287 cd00519, Lipase_3, Lipase (class 3) Back     alignment and domain information
>gnl|CDD|178321 PLN02719, PLN02719, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|215547 PLN03037, PLN03037, lipase class 3 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215176 PLN02310, PLN02310, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|178354 PLN02753, PLN02753, triacylglycerol lipase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 229
PLN02324415 triacylglycerol lipase 100.0
PLN02454414 triacylglycerol lipase 100.0
PLN02571413 triacylglycerol lipase 100.0
PLN02761527 lipase class 3 family protein 100.0
PLN02753531 triacylglycerol lipase 100.0
PLN02719518 triacylglycerol lipase 100.0
PLN02310405 triacylglycerol lipase 100.0
PLN03037525 lipase class 3 family protein; Provisional 100.0
PLN02802509 triacylglycerol lipase 100.0
PLN02408365 phospholipase A1 100.0
KOG4569336 consensus Predicted lipase [Lipid transport and me 100.0
PLN02934515 triacylglycerol lipase 99.86
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 99.86
PLN00413479 triacylglycerol lipase 99.85
PLN02162475 triacylglycerol lipase 99.84
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 99.83
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 99.57
PLN02847 633 triacylglycerol lipase 99.31
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 98.62
COG3675332 Predicted lipase [Lipid metabolism] 97.95
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 97.26
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 97.15
COG5153425 CVT17 Putative lipase essential for disintegration 97.1
KOG4540425 consensus Putative lipase essential for disintegra 97.1
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 96.72
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 94.75
KOG3724 973 consensus Negative regulator of COPII vesicle form 93.92
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 93.19
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 93.02
KOG2564343 consensus Predicted acetyltransferases and hydrola 92.81
PRK10749330 lysophospholipase L2; Provisional 92.55
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 92.52
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 92.18
PLN02965255 Probable pheophorbidase 91.94
PRK10985324 putative hydrolase; Provisional 91.74
COG2267298 PldB Lysophospholipase [Lipid metabolism] 91.68
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 91.6
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 91.56
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 91.5
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 91.23
PHA02857276 monoglyceride lipase; Provisional 90.83
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 90.59
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 90.43
PLN02385349 hydrolase; alpha/beta fold family protein 89.63
TIGR03611257 RutD pyrimidine utilization protein D. This protei 89.51
PRK10673255 acyl-CoA esterase; Provisional 89.37
PLN02298330 hydrolase, alpha/beta fold family protein 89.19
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 89.05
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 88.95
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 88.93
PLN02511388 hydrolase 88.83
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 88.3
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 88.29
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 88.11
PLN02652395 hydrolase; alpha/beta fold family protein 88.04
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 87.79
PLN02211273 methyl indole-3-acetate methyltransferase 87.78
PRK00870302 haloalkane dehalogenase; Provisional 87.63
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 87.32
PRK11071190 esterase YqiA; Provisional 87.24
KOG2369 473 consensus Lecithin:cholesterol acyltransferase (LC 87.13
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 86.85
PRK03204286 haloalkane dehalogenase; Provisional 86.3
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 86.15
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 84.87
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 84.06
KOG1516 545 consensus Carboxylesterase and related proteins [G 83.85
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 83.04
PF00135 535 COesterase: Carboxylesterase family The prints ent 82.89
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 82.87
COG1075336 LipA Predicted acetyltransferases and hydrolases w 82.1
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 81.98
KOG3101283 consensus Esterase D [General function prediction 81.77
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 81.58
COG4782377 Uncharacterized protein conserved in bacteria [Fun 81.37
PLN02824294 hydrolase, alpha/beta fold family protein 80.97
PRK13604307 luxD acyl transferase; Provisional 80.94
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 80.62
PRK10566249 esterase; Provisional 80.52
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 80.5
>PLN02324 triacylglycerol lipase Back     alignment and domain information 
Probab=100.00  E-value=1.1e-80  Score=584.51  Aligned_cols=219  Identities=55%  Similarity=0.999  Sum_probs=207.8

Q ss_pred             CCccCccChhhhhhhcCCCcCCCCceeEeeeEeeeCCCCCChhhhhccccccCCcCCcceEEEEEEecCccccccCccce
Q 047524            1 YAGDSQFGRKNFFSRVGLYKGNPFKYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNWIGYIAVACDEGKAALGRRDI   80 (229)
Q Consensus         1 ~~g~cry~~~~~~~~~g~~~~~~~~Y~vt~~lyat~~~~~p~~~~~~~~~~~~w~~~snw~GyVAvs~de~~~~lgrrdI   80 (229)
                      |||+|||+|++||+++||.++++.+|+|||||||||++.||++|+.+|.++++|++++||+|||||++|+++++||||+|
T Consensus        55 ~~g~~ry~~~~~~~~~~~~~~~~~~Y~vT~~lYAts~~~~p~~f~~~~~~~~~w~~~s~w~GYVAv~~d~~~~~lGrrdI  134 (415)
T PLN02324         55 YAGDCYYSKNELFARTGFLKANPFRYEVTKYIYATASIKLPICFIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDI  134 (415)
T ss_pred             cccccccchhhHHHhhcccccCCCCceEEEEEEeccCCCCcchhhcccccccccccccceeEEEEEeCCccccccCCceE
Confidence            79999999999999999976678899999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeecc-------------------------------------------------------hHHHHHHHHHHHHhhccCC
Q 047524           81 LTAWLR-------------------------------------------------------NEQVLDEVERLLGVYDAED  105 (229)
Q Consensus        81 vva~Rg-------------------------------------------------------r~qvl~eV~~l~~~y~~~~  105 (229)
                      ||||||                                                       ++||+++|++|+++|  ++
T Consensus       135 VVafRGT~t~~eWi~Dl~~~~~~~~~~~p~~~~~~~~kVH~GFl~~Yts~~~~~~f~k~SareqVl~eV~~L~~~Y--p~  212 (415)
T PLN02324        135 VVAWRGTLQPYEWANDFDFPLESAISVFPVTDPKDNPRIGSGWLDIYTASDSRSPYDTTSAQEQVQGELKRLLELY--KN  212 (415)
T ss_pred             EEEEccCCCHHHHHHHhccccccccccCCCCCCCCCceeehhHHHHhcCcCcccccchhHHHHHHHHHHHHHHHHC--CC
Confidence            999998                                                       578999999999999  88


Q ss_pred             CCceEEEeeecCCCc--------c-----------------cceEEEecCCCCCCHHHHHHHhhcCCCcEEEEEECCCCc
Q 047524          106 EEASKTITSHTIGPV--------I-----------------AVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQI  160 (229)
Q Consensus       106 e~~sI~vTGHSLGGA--------~-----------------~V~v~TFGsPRVGn~~Fa~~~~~~~~~~~~RVvn~~DiV  160 (229)
                      ++++|+|||||||||        .                 +|++||||+|||||.+|+++++++...+++||+|.+|+|
T Consensus       213 e~~sItvTGHSLGGALAtLaA~dl~~~~~n~~~~~~~~~~~~V~v~TFGsPRVGN~~Fa~~~~~~~~~~~~RVvn~~D~V  292 (415)
T PLN02324        213 EEISITFTGHSLGAVMSVLSAADLVYGKKNKINISLQKKQVPITVFAFGSPRIGDHNFKNLVDSLQPLNILRIVNVPDVA  292 (415)
T ss_pred             CCceEEEecCcHHHHHHHHHHHHHHHhcccccccccccCCCceEEEEecCCCcCCHHHHHHHHhcCCcceEEEEeCCCcC
Confidence            889999999999999        0                 378999999999999999999987668899999999999


Q ss_pred             ccCCCC------------------------------------------CCCCCeEEeecceEEEeeCCCcccccCCccCC
Q 047524          161 PSYPLL------------------------------------------GSKGGFKLEVKQDIALVNKRMDVLKEDYLVPG  198 (229)
Q Consensus       161 P~lP~~------------------------------------------g~~~~f~l~~~rd~aLvNk~~d~L~de~~vP~  198 (229)
                      |++|+.                                          |++++|+|+++||+|||||++|+|||||+||+
T Consensus       293 P~lP~~~Y~hvG~el~Id~~~Spylk~~~~~~~~H~Le~ylH~v~G~~g~~~~f~l~~~rd~alvnk~~d~L~~~~~vp~  372 (415)
T PLN02324        293 PHYPLLLYTEIGEVLEINTLNSTYLKRSLNFRNYHNLEAYLHGVAGMQDTQGEFKLEINRDIALVNKGLDALEDKYLVPG  372 (415)
T ss_pred             CcCCCcccccCceEEEEcCCCCcccCCCCCccccchHHHHHhhhccccCCCCceeeeccccHhhhcccchhhhhhcCCCc
Confidence            999985                                          66789999999999999999999999999999


Q ss_pred             ceEEecCcceeeCCCCceeecCC
Q 047524          199 KWLCLENTGMVQGEDGNWKLEDH  221 (229)
Q Consensus       199 ~W~~~~nkgmv~~~dg~w~~~~~  221 (229)
                      +|||++||||||++||+|+|++.
T Consensus       373 ~W~~~~nkgmv~~~dg~w~l~~~  395 (415)
T PLN02324        373 HWWVLENKGMVQSDDGTWKLNGD  395 (415)
T ss_pred             hheeecCCccEECCCCcEeCCcc
Confidence            99999999999999999999875

>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>COG3675 Predicted lipase [Lipid metabolism] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
2yij_A419 Crystal Structure Of Phospholipase A1 Length = 419 5e-44
>pdb|2YIJ|A Chain A, Crystal Structure Of Phospholipase A1 Length = 419 Back     alignment and structure 
Iteration: 1

 Score =  174 bits (440), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 162/351 (46%), Gaps = 124/351 (35%)
Query: 1   YAGDSQFGRKNFFSRVGLYKGNPF-KYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESN 59
           +AG S + RK+FF++VGL   +P+ KY+VTKF+YATS   +P +F+   +S E W KESN
Sbjct: 69  FAGASIYSRKDFFAKVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESN 128
Query: 60  WIGYIAVACDEGKAALGRRDILTAWL-------------------------RN------- 87
           W GY+AV  D+G A LGRRDI+ +W                          RN       
Sbjct: 129 WXGYVAVTDDQGTALLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQ 188
Query: 88  ---------------------EQVLDEVERLLGVYDAEDEEASKTITSHTIGPVIA---- 122
                                +QVL EV RLL  Y  +DEE S TI  H++G  +A    
Sbjct: 189 GWYSIYXSQDERSPFTKTNARDQVLREVGRLLEKY--KDEEVSITICGHSLGAALATLSA 246
Query: 123 --------------------VTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPS 162
                               VT F F SP VGD +F+KL   +E + +LR RNL D IP 
Sbjct: 247 TDIVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPI 306
Query: 163 YPLLG-------------------SKGG-------------------------FKLEVKQ 178
           YP +G                   S G                          F+L+V++
Sbjct: 307 YPPIGYSEVGDEFPIDTRKSPYXKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDVER 366
Query: 179 DIALVNKRMDVLKEDYLVPGKWLCLENTGMVQGEDGNWKLEDHEIEDGDGI 229
            I LVNK +D LK++  VPGKW  L+N G  Q +DG+W+L DHEI+D + +
Sbjct: 367 AIGLVNKSVDGLKDECXVPGKWRVLKNKGXAQQDDGSWELVDHEIDDNEDL 417

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 3e-49
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 3e-10
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 8e-10
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 1e-09
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 5e-09
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 2e-08
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 3e-08
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 6e-08
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 1e-07
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 2e-07
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 8e-07
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Length = 419 Back     alignment and structure
 Score =  165 bits (419), Expect = 3e-49
 Identities = 117/347 (33%), Positives = 161/347 (46%), Gaps = 124/347 (35%)

Query: 1   YAGDSQFGRKNFFSRVGLYKGNPF-KYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESN 59
           +AG S + RK+FF++VGL   +P+ KY+VTKF+YATS   +P +F+   +S E W KESN
Sbjct: 69  FAGASIYSRKDFFAKVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESN 128

Query: 60  WIGYIAVACDEGKAALGRRDILTA---------WLRN----------------------- 87
           W+GY+AV  D+G A LGRRDI+ +         W+ +                       
Sbjct: 129 WMGYVAVTDDQGTALLGRRDIVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQ 188

Query: 88  ---------------------EQVLDEVERLLGVYDAEDEEASKTITSHTIGPVIA---- 122
                                +QVL EV RLL  Y  +DEE S TI  H++G  +A    
Sbjct: 189 GWYSIYMSQDERSPFTKTNARDQVLREVGRLLEKY--KDEEVSITICGHSLGAALATLSA 246

Query: 123 --------------------VTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPS 162
                               VT F F SP VGD +F+KL   +E + +LR RNL D IP 
Sbjct: 247 TDIVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPI 306

Query: 163 YPLLG--------------------------------------------SKGGFKLEVKQ 178
           YP +G                                                F+L+V++
Sbjct: 307 YPPIGYSEVGDEFPIDTRKSPYMKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDVER 366

Query: 179 DIALVNKRMDVLKEDYLVPGKWLCLENTGMVQGEDGNWKLEDHEIED 225
            I LVNK +D LK++ +VPGKW  L+N GM Q +DG+W+L DHEI+D
Sbjct: 367 AIGLVNKSVDGLKDECMVPGKWRVLKNKGMAQQDDGSWELVDHEIDD 413
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Length = 269 Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Length = 346 Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Length = 279 Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Length = 269 Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Length = 319 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Length = 279 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Length = 261 Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Length = 258 Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Length = 269 Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 100.0
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 99.93
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 99.92
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 99.91
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 99.9
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 99.9
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 99.89
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 99.89
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 99.88
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 99.84
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 99.82
2qub_A 615 Extracellular lipase; beta roll, alpha/beta hydrol 95.49
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 94.35
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 93.96
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 93.83
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 93.83
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 93.75
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 93.63
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 93.52
1r3d_A264 Conserved hypothetical protein VC1974; structural 93.45
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 93.41
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 93.38
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 93.19
2z8x_A 617 Lipase; beta roll, calcium binding protein, RTX pr 93.12
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 93.06
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 93.0
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 92.97
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 92.95
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 92.91
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 92.83
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 92.81
3lp5_A250 Putative cell surface hydrolase; structural genom 92.78
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 92.65
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 92.64
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 92.54
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 92.51
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 92.46
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 92.33
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 92.28
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 92.21
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 92.16
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 92.1
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 92.1
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 92.09
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 92.09
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 92.04
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 92.04
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 91.98
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 91.97
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 91.89
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 91.82
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 91.81
1iup_A282 META-cleavage product hydrolase; aromatic compound 91.79
3llc_A270 Putative hydrolase; structural genomics, joint cen 91.77
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 91.74
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 91.72
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 91.53
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 91.52
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 91.49
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 91.44
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 91.4
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 91.33
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 91.32
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 91.19
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 91.18
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 91.15
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 91.13
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 91.11
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 90.93
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 90.91
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 90.9
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 90.79
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 90.73
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 90.7
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 90.69
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 90.68
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 90.63
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 90.6
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 90.51
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 90.47
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 90.29
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 90.23
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 90.21
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 90.2
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 90.19
1vkh_A273 Putative serine hydrolase; structural genomics, jo 90.19
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 89.91
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 89.9
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 89.81
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 89.61
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 89.6
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 89.58
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 89.58
3h04_A275 Uncharacterized protein; protein with unknown func 89.57
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 89.36
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 89.23
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 89.14
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 89.13
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 89.11
4fle_A202 Esterase; structural genomics, PSI-biology, northe 89.02
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 88.75
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 88.72
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 88.61
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 88.56
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 88.29
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 88.19
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 88.16
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 88.04
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 87.93
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 87.91
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 87.82
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 87.77
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 87.72
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 87.63
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 87.6
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 87.43
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 87.32
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 87.13
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 86.98
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 86.95
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 86.85
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 86.64
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 86.54
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 86.46
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 86.4
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 86.35
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 86.33
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 86.11
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 86.11
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 86.01
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 85.98
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 85.89
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 85.88
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 85.51
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 85.42
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 84.95
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 84.83
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 84.78
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 84.78
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 84.72
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 84.68
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 84.67
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 84.6
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 84.39
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 84.24
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 84.11
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 83.95
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 83.93
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 83.86
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 83.83
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 83.7
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 83.65
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 82.78
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 82.78
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 82.63
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 83.14
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 82.34
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 82.29
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 82.27
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 82.26
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 82.18
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 82.1
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 82.08
3ain_A323 303AA long hypothetical esterase; carboxylesterase 82.06
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 81.94
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 81.75
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 81.7
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 81.65
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 81.64
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 81.51
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 81.42
3guu_A 462 Lipase A; protein structure, hydrolase; HET: 1PE; 81.29
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 81.01
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 81.01
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 80.96
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 80.79
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 80.73
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 80.61
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 80.27
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 80.22
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 80.21
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=7.7e-76  Score=552.59  Aligned_cols=225  Identities=52%  Similarity=0.944  Sum_probs=208.1

Q ss_pred             CCccCccChhhhhhhcCCCcCCCC-ceeEeeeEeeeCCCCCChhhhhccccccCCcCCcceEEEEEEecCccccccCccc
Q 047524            1 YAGDSQFGRKNFFSRVGLYKGNPF-KYEVTKFLYATSSSPLPAAFIFKSLSSECWHKESNWIGYIAVACDEGKAALGRRD   79 (229)
Q Consensus         1 ~~g~cry~~~~~~~~~g~~~~~~~-~Y~vt~~lyat~~~~~p~~~~~~~~~~~~w~~~snw~GyVAvs~de~~~~lgrrd   79 (229)
                      |||+|||+|++||+++||++++++ +|+||||||||+++.+|++|+.+|+++++|+++++|+|||||++|++++++|||+
T Consensus        69 ~~g~~~y~~~~~~~~~~~~~~~~~~~Y~vt~~lyat~~~~~p~~~~~~~~~~~~w~~~s~~~GYVAv~~d~~~~~lGrk~  148 (419)
T 2yij_A           69 FAGASIYSRKDFFAKVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPISREGWSKESNWMGYVAVTDDQGTALLGRRD  148 (419)
Confidence            799999999999999999754455 9999999999999999999999999999999999999999999999899999999


Q ss_pred             eEEeecc---------------------------------------h--------------HHHHHHHHHHHHhhccCCC
Q 047524           80 ILTAWLR---------------------------------------N--------------EQVLDEVERLLGVYDAEDE  106 (229)
Q Consensus        80 Ivva~Rg---------------------------------------r--------------~qvl~eV~~l~~~y~~~~e  106 (229)
                      |||||||                                       .              +||+++|++++++|  +++
T Consensus       149 IVVafRGT~s~~DWltDL~~~~~~~~~~~g~~~~~~kVH~GF~~ay~~~~~~~~f~~~s~r~~Vl~~l~~ll~~y--p~~  226 (419)
T 2yij_A          149 IVVSWRGSVQPLEWVEDFEFGLVNAIKIFGERNDQVQIHQGWYSIYMSQDERSPFTKTNARDQVLREVGRLLEKY--KDE  226 (419)
Confidence            9999998                                       1              56788889999988  666


Q ss_pred             CceEEEeeecCCCc-------------c-----------cceEEEecCCCCCCHHHHHHHhhcCCCcEEEEEECCCCccc
Q 047524          107 EASKTITSHTIGPV-------------I-----------AVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPS  162 (229)
Q Consensus       107 ~~sI~vTGHSLGGA-------------~-----------~V~v~TFGsPRVGn~~Fa~~~~~~~~~~~~RVvn~~DiVP~  162 (229)
                      +++|+|||||||||             .           ++.+||||+|||||.+|+++++++.+.+++||+|.+|+||+
T Consensus       227 ~~~I~vTGHSLGGALA~L~A~~L~~~~~~~~~~~~~~~~~v~vyTFGsPRVGn~~Fa~~~~~~~~~~~~RVvn~~DiVP~  306 (419)
T 2yij_A          227 EVSITICGHSLGAALATLSATDIVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLEDIRVLRTRNLPDVIPI  306 (419)
Confidence            79999999999999             1           47899999999999999999998756789999999999999


Q ss_pred             CCCC------------------------------------------CCCCC--eEEeecceEEEeeCCCcccccCCccCC
Q 047524          163 YPLL------------------------------------------GSKGG--FKLEVKQDIALVNKRMDVLKEDYLVPG  198 (229)
Q Consensus       163 lP~~------------------------------------------g~~~~--f~l~~~rd~aLvNk~~d~L~de~~vP~  198 (229)
                      +|++                                          |++++  |+++++||+|||||++|+|||||+||+
T Consensus       307 lPp~gY~HvG~ev~id~~~spylk~~~~~~~~H~Le~Ylh~v~g~~g~~~~~~f~~~~~rd~alvnk~~d~l~~~~~vp~  386 (419)
T 2yij_A          307 YPPIGYSEVGDEFPIDTRKSPYMKSPGNLATFHCLEGYLHGVAGTQGTNKADLFRLDVERAIGLVNKSVDGLKDECMVPG  386 (419)
Confidence            9985                                          55666  999999999999999999999999999


Q ss_pred             ceEEecCcceeeCCCCceeecCCCcccCC
Q 047524          199 KWLCLENTGMVQGEDGNWKLEDHEIEDGD  227 (229)
Q Consensus       199 ~W~~~~nkgmv~~~dg~w~~~~~~~~~~~  227 (229)
                      +|||++||||||++||+|+|+|+++||.+
T Consensus       387 ~w~~~~nkgmv~~~~g~w~~~~~~~~~~~  415 (419)
T 2yij_A          387 KWRVLKNKGMAQQDDGSWELVDHEIDDNE  415 (419)
Confidence            99999999999999999999999988654
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 229
d1tiba_269 c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces 3e-04
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Length = 269 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]

 Score = 38.7 bits (89), Expect = 3e-04
 Identities = 22/112 (19%), Positives = 39/112 (34%), Gaps = 16/112 (14%)

Query: 67  ACDEGKAALGRRDILTAWLRNEQVLDEVERLLGVYDAEDEEASKTITSHTIGPVIAV--- 123
             D      G     ++W     V D + + +     E  +     T H++G  +A    
Sbjct: 100 INDICSGCRGHDGFTSSW---RSVADTLRQKVEDAVREHPDYRVVFTGHSLGGALATVAG 156

Query: 124 ----------TVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYPL 165
                      VFS+G+P VG+  F +         + R+ +  D +P  P 
Sbjct: 157 ADLRGNGYDIDVFSYGAPRVGNRAFAEFLTVQTGGTLYRITHTNDIVPRLPP 208

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 99.93
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 99.93
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 99.93
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 99.93
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 99.92
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 95.98
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 95.5
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 95.27
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 95.16
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 94.89
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 94.25
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 93.86
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 93.58
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 93.25
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 93.15
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 92.54
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 92.09
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 92.09
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 92.07
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 92.06
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 92.05
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 92.02
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 91.99
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 91.81
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 91.75
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 91.36
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 91.15
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 91.14
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 90.88
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 90.74
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 90.63
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 89.32
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 89.31
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 89.14
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 88.54
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 88.51
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 88.35
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 87.63
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 87.07
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 87.02
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 87.0
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 86.6
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 86.04
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 85.86
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 84.79
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 83.98
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 83.12
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 82.11
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 80.57
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]

Probab=99.93  E-value=2.2e-26  Score=202.05  Aligned_cols=115  Identities=18%  Similarity=0.349  Sum_probs=95.0

Q ss_pred             CCcceEEEEEEecCccccccCccceEEeecc--------------------------------------hHHHHHHHHHH
Q 047524           56 KESNWIGYIAVACDEGKAALGRRDILTAWLR--------------------------------------NEQVLDEVERL   97 (229)
Q Consensus        56 ~~snw~GyVAvs~de~~~~lgrrdIvva~Rg--------------------------------------r~qvl~eV~~l   97 (229)
                      ...+-.|||+++.+       ++.|||||||                                      .+++.+.|+++
T Consensus        59 ~~~~~~gyi~~d~~-------~k~ivvafRGT~s~~dw~~Dl~~~~~~~~~~~~~~~vH~GF~~~~~~~~~~v~~~v~~~  131 (269)
T d1tiba_          59 GVGDVTGFLALDNT-------NKLIVLSFRGSRSIENWIGNLNFDLKEINDICSGCRGHDGFTSSWRSVADTLRQKVEDA  131 (269)
T ss_dssp             TTTTEEEEEEEETT-------TTEEEEEECCCSCTHHHHTCCCCCEEECTTTSTTCEEEHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCceEEEEEeCC-------CCEEEEEECCCCCHHHHHHhcCccceecccCCCCcEeeHHHHHHHHHHHHHHHHHHHHH
Confidence            34556899999865       6799999998                                      45667777777


Q ss_pred             HHhhccCCCCceEEEeeecCCCc-------------ccceEEEecCCCCCCHHHHHHHhhcCCCcEEEEEECCCCcccCC
Q 047524           98 LGVYDAEDEEASKTITSHTIGPV-------------IAVTVFSFGSPYVGDIEFKKLCDSMEHLHMLRVRNLQDQIPSYP  164 (229)
Q Consensus        98 ~~~y~~~~e~~sI~vTGHSLGGA-------------~~V~v~TFGsPRVGn~~Fa~~~~~~~~~~~~RVvn~~DiVP~lP  164 (229)
                      +++|    +.++|++||||||||             .++.+||||+|||||.+|++++++..+.+++||+|.+|+||+||
T Consensus       132 ~~~~----~~~~i~vtGHSLGGalA~l~a~~l~~~~~~i~~~tFG~PrvGn~~fa~~~~~~~~~~~~Rvv~~~D~VP~lP  207 (269)
T d1tiba_         132 VREH----PDYRVVFTGHSLGGALATVAGADLRGNGYDIDVFSYGAPRVGNRAFAEFLTVQTGGTLYRITHTNDIVPRLP  207 (269)
T ss_dssp             HHHC----TTSEEEEEEETHHHHHHHHHHHHHTTSSSCEEEEEESCCCCBCHHHHHHHHHCTTSCEEEEEETTBSGGGCS
T ss_pred             HHhC----CCcceeeeccchHHHHHHHHHHHHHhccCcceEEEecCCCcCCHHHHHHHHhhcCCceEEEEeCCCeeeeCC
Confidence            7766    468999999999999             47899999999999999999999876678899999999999999


Q ss_pred             CCCCCCCeEEeecceEEEee
Q 047524          165 LLGSKGGFKLEVKQDIALVN  184 (229)
Q Consensus       165 ~~g~~~~f~l~~~rd~aLvN  184 (229)
                      +.  .-+|. |++.++++-+
T Consensus       208 ~~--~~gy~-H~g~Ev~~~~  224 (269)
T d1tiba_         208 PR--EFGYS-HSSPEYWIKS  224 (269)
T ss_dssp             CG--GGTCB-CCSCEEEECS
T ss_pred             CC--CCCcE-ecCeEEEEeC
Confidence            85  23464 5677777743
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure