Citrus Sinensis ID: 047538


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MAKEEEKKVREIEDQNDVESENEETEAIEFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQSTSAVDYSLKEGETLHLHLKNKSSGRVKSKFFEQGLNDLSLDDKGNRKEPVICLKPLPPPPAPLSPATAARMSPSNSPQKFSLEGSSKDASPDSTKEDSKEQHSPESPNTEDIPDDDFGDFQAAG
ccHHHHcccccccccccccccccccccEEEEEEEEccEEEEEccccccccccccccccccccEEEEEEEEEEEccEEEEEEEEccccccEEEEEEccccccccEEEEcccccEEEEEEEcccccEEEEEEEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**************************AIEFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYL***********************KEGETLH***************************************************************************************************DDFGDFQAA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MxxxxxxxxxxxxxxxxxxxxxEETEAIEFVLFQVSECYVYLIPPRKSAASYRADEWNVNKWAWEGMLKVVSKGEECIIKLEDKSTGELYARAFLRKGELHPVEPVIDSSRYFVLRIEENIGGRLRHAFIGIGFRERTEAYDFQAALHDHMKYLDKKKTAEEMEQQFQSTSAVDYSLKEGETLHLHLKNKSSGRVKSKFFEQGLNDLSLDDKGNRKEPVICLKPLPPPPAPLSPATAARMSPSNSPQKFSLEGSSKDASPDSTKEDSKEQHSPESPNTEDIPDDDFGDFQAAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adaptin ear-binding coat-associated protein 2 Involved in endocytosis.probableQ6P756
Adaptin ear-binding coat-associated protein 1 Involved in endocytosis.probableQ9CR95
Adaptin ear-binding coat-associated protein 2 Involved in endocytosis.probableQ5E9Q4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TQZ, chain A
Confidence level:very confident
Coverage over the Query: 25-157
View the alignment between query and template
View the model in PyMOL