Citrus Sinensis ID: 047551

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--

MDGNKDEALRCIRIAEEAIASGKKQRALKFIKIAQRLNDNLSVHEVLAACEKLGVGDSGPNVSSADEKRLDDQRSKPGLEKLGEGLSGERSYTEEHVELIRQIKRNKDYYAILGVERSCSVEEIRKAYRKLSLKVHPDKNKAPGSEEAFKKVCKAFKCLSDDDSRRHYDHVGLVDEFEHNQRHNVRPRRRRAQHDFFDDELDPDEIFRSFFGQQDMFRTTRVYRTRGMRSQEREEFHGAGLNFVFLLQILPFLLIFLLAYLPYSEPDYSLHRNFNYQIPRTTEKHGIEFYVKSPASFDENFPHGSSARAVIEDNVIKDYRNLLWRYCHVELQKRRWNKNLPTPHCNKLENLD

ccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEcccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHccc

****KDEALRCIRIAEEAIASGKKQRALKFIKIAQRLNDNLSVHEVLAACEKL******************************************HVELIRQIKRNKDYYAILGVERSCSVEEIRKAYRKLSLKVHPDKNKAPGSEEAFKKVCKAFKCLSDDDSRRHYDHVGL*********************DFFDDELDPDEIFRSFFGQQDMFRTTRVYRTR***********GAGLNFVFLLQILPFLLIFLLAYLPYSEPDYSLHRNFNYQIPRTTEKHGIEFYVKSPASFDENFPHGSSARAVIEDNVIKDYRNLLWRYCHVELQKRRWNKN**TPHCNKLENL*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Chaperone protein dnaJ 49	Have a continuous role in plant development probably in the structural organization of compartments.	probable	Q9FH28
DnaJ homolog subfamily B member 12		probable	Q58DR2
DnaJ homolog subfamily B member 12		probable	Q9QYI4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y4T, chain A
Confidence level:very confident
Coverage over the Query: 10-165
View the alignment between query and template
View the model in PyMOL

Template: 1BQ0, chain A
Confidence level:very confident
Coverage over the Query: 106-171
View the alignment between query and template
View the model in PyMOL