Citrus Sinensis ID: 047551
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 352 | ||||||
| 255551777 | 356 | Chaperone protein dnaJ, putative [Ricinu | 0.994 | 0.983 | 0.723 | 1e-132 | |
| 449460955 | 348 | PREDICTED: chaperone protein dnaJ 49-lik | 0.974 | 0.985 | 0.637 | 1e-131 | |
| 449522791 | 348 | PREDICTED: LOW QUALITY PROTEIN: chaperon | 0.974 | 0.985 | 0.634 | 1e-131 | |
| 359477190 | 353 | PREDICTED: chaperone protein dnaJ 49 [Vi | 0.991 | 0.988 | 0.707 | 1e-123 | |
| 224110434 | 354 | predicted protein [Populus trichocarpa] | 0.980 | 0.974 | 0.661 | 1e-116 | |
| 356556090 | 361 | PREDICTED: chaperone protein dnaJ 49-lik | 0.980 | 0.955 | 0.595 | 1e-109 | |
| 356529523 | 358 | PREDICTED: chaperone protein dnaJ 49-lik | 0.951 | 0.935 | 0.572 | 1e-108 | |
| 217072054 | 363 | unknown [Medicago truncatula] gi|3885210 | 0.982 | 0.953 | 0.598 | 1e-102 | |
| 10176939 | 350 | DNAJ-like protein [Arabidopsis thaliana] | 0.968 | 0.974 | 0.600 | 1e-102 | |
| 30695598 | 354 | chaperone protein dnaJ 49 [Arabidopsis t | 0.968 | 0.963 | 0.600 | 1e-102 |
| >gi|255551777|ref|XP_002516934.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|223544022|gb|EEF45548.1| Chaperone protein dnaJ, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 478 bits (1229), Expect = e-132, Method: Compositional matrix adjust.
Identities = 256/354 (72%), Positives = 303/354 (85%), Gaps = 4/354 (1%)
Query: 1 MDGNKDEALRCIRIAEEAIASGKKQRALKFIKIAQRLNDNLSVHEVLAACEKLGVGDSGP 60
MDGNKDEALRCIRIAEEAIAS K+RALKFI+IAQRLN +LSV+++L ACEKLG S
Sbjct: 1 MDGNKDEALRCIRIAEEAIASRNKERALKFIRIAQRLNHDLSVNDLLTACEKLGSSGSNS 60
Query: 61 NVSSADEKRL--DDQRSKPGLEKLGEGLSGERSYTEEHVELIRQIKRNKDYYAILGVERS 118
N S DEK + D ++KP K+ EGL+GE++YTEEHVELIRQ+K NKDYY+ILGVE++
Sbjct: 61 NPPSLDEKCVLNGDAKNKPSHGKIDEGLNGEKNYTEEHVELIRQVKINKDYYSILGVEKT 120
Query: 119 CSVEEIRKAYRKLSLKVHPDKNKAPGSEEAFKKVCKAFKCLSDDDSRRHYDHVGLVDEFE 178
SVE+IR+AYRKLSLKVHPDKNKAPGSEEAFKKVCKAFKCLSDD+SRR YD GLVDEFE
Sbjct: 121 SSVEDIRRAYRKLSLKVHPDKNKAPGSEEAFKKVCKAFKCLSDDNSRRQYDQTGLVDEFE 180
Query: 179 HNQRHNVRPRRRRAQ-HDFFDDELDPDEIFRSFFGQQDMFRTTRVYRTRGMRSQEREEFH 237
+NQ++NVR RRR HDF+DD+ DP+EIFRSFFGQ DMFR VYR+ Q+R EFH
Sbjct: 181 YNQQYNVRRTRRRRNVHDFYDDDFDPNEIFRSFFGQTDMFRAHHVYRSGATAGQQRGEFH 240
Query: 238 GAGLNFVFLLQILPFLLIFLLAYLPYSEPDYSLHRNFNYQIPRTTEKHGIEFYVKSPASF 297
G G + + LLQILPFLLIFLLAYLP+SEPDYSLH+N++YQIP+TTEKHG+EF+VKS ASF
Sbjct: 241 GGGPSLLLLLQILPFLLIFLLAYLPFSEPDYSLHKNYSYQIPKTTEKHGLEFFVKS-ASF 299
Query: 298 DENFPHGSSARAVIEDNVIKDYRNLLWRYCHVELQKRRWNKNLPTPHCNKLENL 351
D+N+P GS+ARA IEDNVIKDYRN+LWR+CH+ELQ+R W+KN+PTPHC+KL NL
Sbjct: 300 DDNYPIGSTARANIEDNVIKDYRNVLWRHCHIELQRRHWSKNMPTPHCDKLHNL 353
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449460955|ref|XP_004148209.1| PREDICTED: chaperone protein dnaJ 49-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449522791|ref|XP_004168409.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein dnaJ 49-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359477190|ref|XP_002268185.2| PREDICTED: chaperone protein dnaJ 49 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224110434|ref|XP_002315518.1| predicted protein [Populus trichocarpa] gi|222864558|gb|EEF01689.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356556090|ref|XP_003546360.1| PREDICTED: chaperone protein dnaJ 49-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356529523|ref|XP_003533340.1| PREDICTED: chaperone protein dnaJ 49-like isoform 1 [Glycine max] gi|356529525|ref|XP_003533341.1| PREDICTED: chaperone protein dnaJ 49-like isoform 2 [Glycine max] gi|356529527|ref|XP_003533342.1| PREDICTED: chaperone protein dnaJ 49-like isoform 3 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|217072054|gb|ACJ84387.1| unknown [Medicago truncatula] gi|388521051|gb|AFK48587.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|10176939|dbj|BAB10088.1| DNAJ-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|30695598|ref|NP_199717.2| chaperone protein dnaJ 49 [Arabidopsis thaliana] gi|67462414|sp|Q9FH28.2|DNJ49_ARATH RecName: Full=Chaperone protein dnaJ 49; Short=AtDjC49; Short=AtJ49 gi|332008384|gb|AED95767.1| chaperone protein dnaJ 49 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 352 | ||||||
| TAIR|locus:2155184 | 354 | AT5G49060 [Arabidopsis thalian | 0.968 | 0.963 | 0.558 | 3.7e-96 | |
| TAIR|locus:2082538 | 367 | AT3G57340 [Arabidopsis thalian | 0.985 | 0.945 | 0.372 | 1.6e-61 | |
| TAIR|locus:2166404 | 294 | AT5G05750 [Arabidopsis thalian | 0.630 | 0.755 | 0.445 | 6.9e-47 | |
| MGI|MGI:1931881 | 376 | Dnajb12 "DnaJ (Hsp40) homolog, | 0.900 | 0.843 | 0.332 | 2.1e-38 | |
| UNIPROTKB|Q58DR2 | 370 | DNAJB12 "DnaJ homolog subfamil | 0.900 | 0.856 | 0.327 | 1.1e-37 | |
| UNIPROTKB|Q9NXW2 | 375 | DNAJB12 "DnaJ homolog subfamil | 0.900 | 0.845 | 0.327 | 1.5e-37 | |
| ZFIN|ZDB-GENE-070410-128 | 369 | dnajb12b "DnaJ (Hsp40) homolog | 0.892 | 0.850 | 0.315 | 8.3e-35 | |
| POMBASE|SPBC17A3.05c | 403 | SPBC17A3.05c "DNAJ/DUF1977 DNA | 0.687 | 0.600 | 0.298 | 4.4e-34 | |
| ZFIN|ZDB-GENE-061110-138 | 380 | zgc:153638 "zgc:153638" [Danio | 0.894 | 0.828 | 0.301 | 9.5e-34 | |
| WB|WBGene00001019 | 401 | dnj-1 [Caenorhabditis elegans | 0.656 | 0.576 | 0.325 | 2.6e-32 |
| TAIR|locus:2155184 AT5G49060 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 956 (341.6 bits), Expect = 3.7e-96, P = 3.7e-96
Identities = 197/353 (55%), Positives = 247/353 (69%)
Query: 1 MDGNKDEALRCIRIAEEAIASGKKQRALKFIKIAQRLNDNLSVHEVLAACEKLGVGDSGP 60
MDGNKD+A RC+RIAE+AI SG K+RALKFI +A+RLN +LSV E++AAC+ L DS
Sbjct: 1 MDGNKDDASRCLRIAEDAIVSGDKERALKFINMAKRLNPSLSVDELVAACDNL---DSVS 57
Query: 61 NVSSADEKRLDDQRSKPXXXXXXXXXXXXRSYTEEHVELIRQIKRNKDYYAILGVERSCS 120
SS EK K YTEE+V+L+R I RN DYYAILG+E++CS
Sbjct: 58 RNSSVSEKL------KTMDGDDDKLETGKMKYTEENVDLVRNIIRNNDYYAILGLEKNCS 111
Query: 121 VEEIRKAYRKLSLKVHPDKNKAPGSEEAFKKVCKAFKCLSDDDSRRHYDHVGLVDEFEHN 180
V+EIRKAYRKLSLKVHPDKNKAPGSEEAFKKV KAF CLSD +SRR +D VG+VDEF+H
Sbjct: 112 VDEIRKAYRKLSLKVHPDKNKAPGSEEAFKKVSKAFTCLSDGNSRRQFDQVGIVDEFDHV 171
Query: 181 QRHNVX-XXXXXAQHDFFDDELDPDEIFRSFFGQQ-DMFRTTRVYRTRGMRSQEREE-FH 237
QR N ++DFFDDE DP+EIFR+ FGQQ ++FR + YRTR R+Q REE +
Sbjct: 172 QRRNRRPRRRYNTRNDFFDDEFDPEEIFRTVFGQQREVFRASHAYRTRQPRNQFREEEIN 231
Query: 238 GAGLNFVFXXXXXXXXXXXXXXXXXXSEPDYSLHRNFNYQIPRTTEKHGIEFYVKSPASF 297
AG + + SEPDYSLH+N +YQIP+TT+ I FYV+S ++F
Sbjct: 232 VAGPSCLTIIQILPFFLLLLLAYLPFSEPDYSLHKNQSYQIPKTTQNTEISFYVRSASAF 291
Query: 298 DENFPHGSSARAVIEDNVIKDYRNLLWRYCHVELQKRRWNKNLPTPHCNKLEN 350
DE FP SSARA +E NVIK+Y++ L++ C +ELQKRRWNK +PTPHC +L++
Sbjct: 292 DEKFPLSSSARANLEGNVIKEYKHFLFQSCRIELQKRRWNKKIPTPHCIELQD 344
|
|
| TAIR|locus:2082538 AT3G57340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166404 AT5G05750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1931881 Dnajb12 "DnaJ (Hsp40) homolog, subfamily B, member 12" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DR2 DNAJB12 "DnaJ homolog subfamily B member 12" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NXW2 DNAJB12 "DnaJ homolog subfamily B member 12" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070410-128 dnajb12b "DnaJ (Hsp40) homolog, subfamily B, member 12b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC17A3.05c SPBC17A3.05c "DNAJ/DUF1977 DNAJB12 homolog (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061110-138 zgc:153638 "zgc:153638" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00001019 dnj-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00033001001 | SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (352 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00024351001 | • | • | 0.882 | ||||||||
| GSVIVG00021301001 | • | • | 0.882 | ||||||||
| GSVIVG00024357001 | • | • | 0.882 | ||||||||
| GSVIVG00033448001 | • | 0.800 | |||||||||
| GSVIVG00012527001 | • | 0.800 | |||||||||
| GSVIVG00006484001 | • | 0.800 | |||||||||
| GSVIVG00031635001 | • | 0.478 | |||||||||
| GSVIVG00017724001 | • | 0.471 | |||||||||
| GSVIVG00022013001 | • | 0.468 | |||||||||
| GSVIVG00017185001 | • | 0.463 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 352 | |||
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 1e-25 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 6e-25 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 8e-23 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 2e-21 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 4e-21 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 7e-21 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 1e-20 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 1e-20 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 2e-20 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 4e-20 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 5e-20 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 1e-19 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 2e-19 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 3e-19 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 5e-19 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 2e-18 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 5e-18 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 5e-18 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 1e-17 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 6e-17 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 6e-17 | |
| pfam09320 | 107 | pfam09320, DUF1977, Domain of unknown function (DU | 7e-17 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 9e-17 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 2e-16 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 2e-16 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 2e-16 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 2e-16 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 2e-16 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 1e-15 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 1e-15 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 7e-15 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 1e-14 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 1e-13 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 1e-12 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 5e-12 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 5e-12 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 6e-10 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 2e-09 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 4e-06 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 6e-05 | |
| PHA03102 | 153 | PHA03102, PHA03102, Small T antigen; Reviewed | 8e-04 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 0.001 | |
| PHA02624 | 647 | PHA02624, PHA02624, large T antigen; Provisional | 0.003 |
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 105 bits (264), Expect = 1e-25
Identities = 42/108 (38%), Positives = 56/108 (51%), Gaps = 11/108 (10%)
Query: 106 NKDYYAILGVERSCSVEEIRKAYRKLSLKVHPDKNKA-PGSEEAFKKVCKAFKCLSDDDS 164
+DYY ILGV + S EEI+KAYRKL+ K HPD+N +EE FK++ +A++ LSD +
Sbjct: 3 KRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEK 62
Query: 165 RRHYDHVGLVDEFEHNQRHNVRPRRRRAQHDFFDDELDPDEIFRSFFG 212
R YD G F+ F D +IF FFG
Sbjct: 63 RAAYDQFG-HAGFKAGGFG---------GFGFGGFGGDFGDIFEDFFG 100
|
Length = 371 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|150099 pfam09320, DUF1977, Domain of unknown function (DUF1977) | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 352 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.94 | |
| PF09320 | 107 | DUF1977: Domain of unknown function (DUF1977); Int | 99.93 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.9 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.89 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.87 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.86 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.86 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.85 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.84 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.83 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.83 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.83 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.83 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.82 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.82 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.82 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.82 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.81 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.81 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.81 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.79 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.79 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.79 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.79 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.78 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.76 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.75 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.75 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.74 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.73 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.72 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.72 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.71 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.7 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.69 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.68 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.66 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.64 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.59 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.59 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.59 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.57 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.54 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.53 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.53 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.37 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.35 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.32 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.29 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.27 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.22 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.2 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.12 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.07 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.99 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.84 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.78 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.75 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.08 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.02 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.73 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.65 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 96.38 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 96.38 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.12 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 96.08 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 95.7 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 95.36 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 94.38 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 94.34 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 94.17 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 93.2 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 92.68 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 92.36 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 91.46 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 91.37 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 90.61 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 90.53 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 90.35 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 89.96 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 89.7 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 89.24 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 85.87 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 84.76 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 84.52 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 81.76 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 81.58 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 80.77 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.4e-27 Score=234.00 Aligned_cols=99 Identities=42% Similarity=0.703 Sum_probs=82.0
Q ss_pred CCCchhhcCcCCCCCHHHHHHHHHHhhhhhCCCCCC-CCCcHHHHHHHHHHHHhcCchhhhhhhcccCCcchhhccccCC
Q 047551 106 NKDYYAILGVERSCSVEEIRKAYRKLSLKVHPDKNK-APGSEEAFKKVCKAFKCLSDDDSRRHYDHVGLVDEFEHNQRHN 184 (352)
Q Consensus 106 ~~d~Y~iLgv~~~a~~~eIkkaYrkla~~~HPDk~~-~~~a~e~f~~I~~Ay~vLsd~~kR~~YD~~g~~~~~~~~~~~~ 184 (352)
.+|||+||||+++||.+||||||||||++||||+|+ +++|+++|++|++||+|||||+||+.||++|. .++..+.
T Consensus 3 ~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~-~~~~~gg--- 78 (371)
T COG0484 3 KRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGH-AGFKAGG--- 78 (371)
T ss_pred ccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCc-cccccCC---
Confidence 689999999999999999999999999999999999 89999999999999999999999999999998 5543110
Q ss_pred CCCCCcCCCCCCCCCCCChHHHHHhhhCCC
Q 047551 185 VRPRRRRAQHDFFDDELDPDEIFRSFFGQQ 214 (352)
Q Consensus 185 ~~~~~~~~~~~~~~~~~~pediF~~fFGg~ 214 (352)
.+ +.+.++ |+. ++.|||..||||+
T Consensus 79 --~g-g~g~~~-fgg--~~~DIF~~~FgGg 102 (371)
T COG0484 79 --FG-GFGFGG-FGG--DFGDIFEDFFGGG 102 (371)
T ss_pred --cC-CCCcCC-CCC--CHHHHHHHhhcCC
Confidence 00 001112 221 7899999999755
|
|
| >PF09320 DUF1977: Domain of unknown function (DUF1977); InterPro: IPR015399 This C-terminal domain is functionally uncharacterised and predominantly found in Dnaj-like proteins | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 352 | ||||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 4e-16 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 1e-13 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 2e-13 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 4e-13 | ||
| 2ys8_A | 90 | Solution Structure Of The Dnaj-Like Domain From Hum | 2e-12 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 4e-12 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 2e-11 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 3e-11 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 6e-11 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 6e-11 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 6e-11 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 7e-11 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 7e-11 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 1e-10 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 2e-10 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 4e-10 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 1e-09 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 6e-09 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 1e-08 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 6e-08 | ||
| 2ctq_A | 112 | Solution Structure Of J-Domain From Human Dnaj Subf | 3e-07 | ||
| 2y4u_A | 450 | Crystal Structure Of Human P58(Ipk) In Space Group | 2e-06 | ||
| 2y4t_A | 450 | Crystal Structure Of The Human Co-Chaperone P58(Ipk | 2e-06 | ||
| 2l6l_A | 155 | Solution Structure Of Human J-Protein Co-Chaperone, | 1e-05 | ||
| 1wjz_A | 94 | Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P | 2e-05 |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
|
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 | Back alignment and structure |
| >pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 | Back alignment and structure |
| >pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 | Back alignment and structure |
| >pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 | Back alignment and structure |
| >pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 352 | |||
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 3e-37 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 5e-28 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 3e-26 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 1e-25 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 2e-25 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 4e-24 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 7e-24 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 2e-23 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 8e-23 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 8e-23 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 1e-22 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 3e-22 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 5e-22 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 5e-22 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 6e-22 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 6e-22 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 7e-22 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 9e-22 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 2e-21 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 3e-21 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 8e-21 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 1e-20 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 2e-20 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 9e-16 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 6e-14 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 8e-14 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 9e-12 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 2e-11 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 3e-11 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 4e-11 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 9e-09 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 1e-08 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 4e-05 |
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
Score = 128 bits (323), Expect = 3e-37
Identities = 34/83 (40%), Positives = 50/83 (60%)
Query: 87 SGERSYTEEHVELIRQIKRNKDYYAILGVERSCSVEEIRKAYRKLSLKVHPDKNKAPGSE 146
S+T+E + IR+I+ +KD + +LGV+ S +E+ KAYRKL++ +HPDK APGSE
Sbjct: 7 GSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSE 66
Query: 147 EAFKKVCKAFKCLSDDDSRRHYD 169
+AFK V A L +
Sbjct: 67 DAFKAVVNARTALLKNIKSGPSS 89
|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 352 | |||
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.86 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.83 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.83 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.81 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.8 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.8 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.8 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.8 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.8 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.79 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.77 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.77 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.77 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.77 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.76 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.76 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.75 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.72 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.72 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.69 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.68 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.65 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.64 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.63 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.6 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.6 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.6 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.58 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.58 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.57 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.55 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.53 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.52 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.48 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.69 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.14 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 93.91 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 93.68 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 93.48 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 92.77 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 91.8 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 91.6 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 91.38 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 90.71 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 90.62 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 90.46 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 90.27 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 90.09 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 90.0 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 89.98 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 89.86 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 89.79 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 88.99 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 88.97 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 88.0 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 87.74 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 87.69 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 87.35 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 87.12 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 86.95 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 86.8 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 86.73 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 86.53 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 86.42 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 85.81 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 85.6 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 85.44 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 85.29 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 85.14 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 85.13 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 84.9 | |
| 3ax2_A | 73 | Mitochondrial import receptor subunit TOM20 homol; | 84.88 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 84.53 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 84.37 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 84.27 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 84.07 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 83.91 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 83.85 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 83.65 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 83.62 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 83.44 | |
| 1om2_A | 95 | Protein (mitochondrial import receptor subunit TOM | 83.38 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 83.05 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 83.01 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 83.0 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 82.93 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 82.7 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 82.69 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 82.58 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 82.34 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 82.17 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 82.06 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 81.24 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 80.85 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 80.7 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 80.66 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 80.54 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 80.27 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 80.03 |
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
Probab=99.86 E-value=1.9e-22 Score=164.67 Aligned_cols=98 Identities=38% Similarity=0.706 Sum_probs=66.9
Q ss_pred CCCchhhcCcCCCCCHHHHHHHHHHhhhhhCCCCCC-CCCcHHHHHHHHHHHHhcCchhhhhhhcccCCcchhhccccCC
Q 047551 106 NKDYYAILGVERSCSVEEIRKAYRKLSLKVHPDKNK-APGSEEAFKKVCKAFKCLSDDDSRRHYDHVGLVDEFEHNQRHN 184 (352)
Q Consensus 106 ~~d~Y~iLgv~~~a~~~eIkkaYrkla~~~HPDk~~-~~~a~e~f~~I~~Ay~vLsd~~kR~~YD~~g~~~~~~~~~~~~ 184 (352)
..|||+||||+++|+.++||+|||+|++++|||++. .+.+++.|+.|++||+||+||.+|+.||..|. .+...+
T Consensus 2 ~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~~~-~~~~~~---- 76 (103)
T 1bq0_A 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGH-AAFEQG---- 76 (103)
T ss_dssp CCCSTTTTSSCSSCCHHHHHHHHHHHHTTTCTTTCTTTCTHHHHHHHHTTTTTSTTCSHHHHHTTTSTT-TSSCSC----
T ss_pred CCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCCCcHHHHHHHHHHHHHHHHHCCHHHHHHHHHHhh-hhhccc----
Confidence 468999999999999999999999999999999998 47889999999999999999999999999997 443311
Q ss_pred CCCCCcCCCCCCCCCCCChHHHHHhhhCCC
Q 047551 185 VRPRRRRAQHDFFDDELDPDEIFRSFFGQQ 214 (352)
Q Consensus 185 ~~~~~~~~~~~~~~~~~~pediF~~fFGg~ 214 (352)
.. +.++ +...+++.++|..|||+.
T Consensus 77 --~~---~~~~-~~~~~~~~~~f~~~f~~~ 100 (103)
T 1bq0_A 77 --GM---GGGG-FGGGADFSDIFGDVFGDI 100 (103)
T ss_dssp --C---------------------------
T ss_pred --Cc---CCCC-CCCCCCHHHHHHHHHHhh
Confidence 00 0011 111234568888888653
|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 352 | ||||
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 3e-15 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 5e-15 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 1e-14 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 2e-13 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 7e-13 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 3e-12 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 1e-11 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 6e-11 |
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 68.5 bits (167), Expect = 3e-15
Identities = 22/70 (31%), Positives = 42/70 (60%), Gaps = 7/70 (10%)
Query: 107 KDYYAILGVERSCSVEEIRKAYRKLSLKVHPDKNKAPGSEEA-------FKKVCKAFKCL 159
KD+Y+ILG + S ++ ++++ Y+KL L HPDK A F ++ +A+K L
Sbjct: 16 KDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKIL 75
Query: 160 SDDDSRRHYD 169
++++++ YD
Sbjct: 76 GNEETKKKYD 85
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 352 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.85 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.78 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.77 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.68 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.63 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.58 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.53 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 94.5 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 94.36 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 94.1 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 93.83 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 93.66 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 93.33 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 92.98 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 92.51 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 89.31 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 88.16 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 86.72 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 86.51 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 86.49 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 86.14 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 84.71 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 84.63 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 84.03 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 83.91 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 83.72 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 83.33 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 81.93 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 81.68 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 81.52 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.85 E-value=2.5e-22 Score=153.40 Aligned_cols=68 Identities=43% Similarity=0.828 Sum_probs=64.2
Q ss_pred CCCchhhcCcCCCCCHHHHHHHHHHhhhhhCCCCCCC-CCcHHHHHHHHHHHHhcCchhhhhhhcccCC
Q 047551 106 NKDYYAILGVERSCSVEEIRKAYRKLSLKVHPDKNKA-PGSEEAFKKVCKAFKCLSDDDSRRHYDHVGL 173 (352)
Q Consensus 106 ~~d~Y~iLgv~~~a~~~eIkkaYrkla~~~HPDk~~~-~~a~e~f~~I~~Ay~vLsd~~kR~~YD~~g~ 173 (352)
..|||+||||+++||.++||+|||+|++++|||++.. +.+++.|+.|++||+||+||.+|..||.+|.
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~ 70 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGH 70 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTT
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCc
Confidence 5799999999999999999999999999999999974 5677889999999999999999999999987
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|