Citrus Sinensis ID: 047604

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--

MVFMADLREKHQQELENLTLTTQPFKTIKLFILGVIQYLKRSVLYLLAKGGWLMLSCTVVAALGILLVTIDGPHEKHLEELSEYFRFGLWWVALGVASSIGLGSGLHTFVLYLGPHIALFTIKAMQCGRVDLKSAPYDTIQLKRGPSWLDKDCDEFGPPLFSSSEGSRVPLSSILPQVQLEAILWGVGTALGELPPYFISRAASISGSRLDAMDEFDDSSTESDGVVPNPLFDLAGIMCGQFGVPFWKFFLATLIGKAIIKTHIQTVFIISVCNNQLLDWIENELIWVLSLVPGFAPVLPSLVAKLHTMRAKYLKPQQPSSHIKVKKWDFSFASVWNTIVWLMLMNFFVKIVTDTAQRYLKKQQDKEIAALTNNSSASRQSS

cHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHEEEEEEEEcHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc

****************NLTLTTQPFKTIKLFILGVIQYLKRSVLYLLAKGGWLMLSCTVVAALGILLVTIDGPHEKHLEELSEYFRFGLWWVALGVASSIGLGSGLHTFVLYLGPHIALFTIKAMQCGRVDLKSAPYDTIQLKRGPSWLDKDCDEFGPPLFSSSEGSRVPLSSILPQVQLEAILWGVGTALGELPPYFISRAASISGSRLDAMDEFDDSSTESDGVVPNPLFDLAGIMCGQFGVPFWKFFLATLIGKAIIKTHIQTVFIISVCNNQLLDWIENELIWVLSLVPGFAPVLPSLVAKLHTMRAKY************KKWDFSFASVWNTIVWLMLMNFFVKIVTDTAQRYL**********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vacuole membrane protein 1	Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions. Plays a role in the initial stages of the autophagic process through its interaction with BECN1.	probable	Q0VCK9
Vacuole membrane protein 1	Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Involved in cell-cell adhesion (By similarity). Plays an essential role in formation of cell junctions (By similarity). Plays a role in the initial stages of the autophagic process through its interaction with BECN1.	probable	Q91ZQ0
Vacuole membrane protein 1		probable	Q68EQ9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!