Citrus Sinensis ID: 047623


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340
MLSLIPSPTIQFKPLFPSKTIKPLKPFSSKSSIQSVLQWNRKPELAGETPRVVVITSGKGGVGKTTTTANVGLSLARLGFSVVAIDADVGLRNLDLLLGLENRVNYTVVEVLNGDCRLDQALVRDKRWSNFELLCISKPRSKLPLGFGGKALTWVVEALKSRQEGSPDFILIDCPAGIDAGFITAITPANEAVLVTTPDITSLRDADRVTGLLECDGIRDIKMVVNRVRTDMIKGEDMMSVLDIQEMLGLALLGVIPEDSEVIRSTNRGYPLVLNKPPTLAGLAFEQAAWRLVEQDSMKAVMVEEEPKRRGFFSFFGLGVLAVTVGLEVGSVVFPILLIR
ccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEcccccccccHHccccccccccHHHHHcccccccEEEEcccccccEEEEEcccccccccccccHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHccccccEEEEEcccccHHHccccccHHHHHHHccccEEEECccccHHHHHHccccCEEEcccccHHHHHHHHHHHHHHcccccHHHHcccccccccHHHHHHHHHHccccccccccEEEEEEEEc
*******PTIQ*************************LQWN****LAGETPRVVVITSGKGGVGKTTTTANVGLSLARLGFSVVAIDADVGLRNLDLLLGLENRVNYTVVEVLNGDCRLDQALVRDKRWSNFELLCISKPRSKLPLGFGGKALTWVVEALKSRQEGSPDFILIDCPAGIDAGFITAITPANEAVLVTTPDITSLRDADRVTGLLECDGIRDIKMVVNRVRTDMIKGEDMMSVLDIQEMLGLALLGVIPEDSEVIRSTNRGYPLVLNKPPTLAGLAFEQAAWRLVEQDSMKAVMVEEEPKRRGFFSFFGLGVLAVTVGLEVGSVVFPILLIR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSLIPSPTIQFKPLFPSKTIKPLKPFSSKSSIQSVLQWNRKPELAGETPRVVVITSGKGGVGKTTTTANVGLSLARLGFSVVAIDADVGLRNLDLLLGLENRVNYTVVEVLNGDCRLDQALVRDKRWSNFELLCISKPRSKLPLGFGGKALTWVVEALKSRQEGSPDFILIDCPAGIDAGFITAITPANEAVLVTTPDITSLRDADRVTGLLECDGIRDIKMVVNRVRTDMIKGEDMMSVLDIQEMLGLALLGVIPEDSEVIRSTNRGYPLVLNKPPTLAGLAFEQAAWRLVEQDSMKAVMVEEEPKRRGFFSFFGLGVLAVTVGLEVGSVVFPILLIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative septum site-determining protein minD homolog, chloroplastic Calcium-dependent ATPase required for the correct placement of the plastid division site. Inhibits FtsZ filament and ring formation in the plastid. Mediates inhibition of plastid division. In cooperation with MINE1, prevents FtsZ ring formation anywhere outside of the mid-plastids.confidentQ9MBA2
Putative septum site-determining protein MinD ATPase required for the correct placement of the division site.probableQ20EV4
Putative septum site-determining protein MinD ATPase required for the correct placement of the division site.probableO78436

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HYQ, chain A
Confidence level:very confident
Coverage over the Query: 50-292
View the alignment between query and template
View the model in PyMOL
Template: 3FWY, chain A
Confidence level:very confident
Coverage over the Query: 49-317
View the alignment between query and template
View the model in PyMOL
Template: 3BFV, chain A
Confidence level:confident
Coverage over the Query: 4-230
View the alignment between query and template
View the model in PyMOL