Citrus Sinensis ID: 047655

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370
MSSNVVRPRIFQILSKISNRNCSKYRRGFSSDTVSGAPKKEPIIASQSIVGDISAPPEVEAAEEAAAPNEVRKSSWRFLTYGIVATLTGVTAGAGYLTYAYSTDEIEEKTRSLRESVNYTAGDDTSASEKYQGLLYSAAMTVPAKAVEIYLDLRRLIEEQVRGFTEPTSDKLLPDLHPAEQHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVYSDQLNMYVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIRAVLASYEKKDIAKEFLERSKDYQRRMQEQRQHNKSFWRR
cccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEccccEEcccccccccEEEEEcccHHHHHHHHHccccEEEEEccccccHHHHHHHHcccccccccccccccccccccEEEcccccccccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccc
cccHHHHHHHHHHHHHccccccccccccccccccccccccccEEEccccccccccccccccccccccccHHHHcHHHHHHHHHHHHHHHHHHHccccEEEcccHHcccccHHHHcccccccccccccHHHHHHHHHHHHHHccHccccccccHHHHHHHHcccccccccHcccccccccccccEEEEEEcccEEEcccccccccEEEEccccHHHHHHHHHHHEEEEEEEccHHHHcHHHHHHcccccEEEEEEEEccEEEcccccEccHHHHcccccEEEEEEccccHcEEcccccEEcccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccEEEcc
mssnvvrpRIFQILSKIsnrncskyrrgfssdtvsgapkkepiiasqsivgdisappeveaaeeaaapnevrkSSWRFLTYGIVATLTGVTAGAGYLTYAYSTDEIEEKTRSLRESvnytagddtsaseKYQGLLYSAAMTVPAKAVEIYLDLRRLIEEQVrgfteptsdkllpdlhpaeQHVFTLVLDLNETllysdwkrdrgwrtfkrpgVDAFLEHMAKFYEIVVYSDqlnmyvdpvcerldtnhciryrlsrgatkyqdgkhyrdlsklnrdpakiLYVSghafesslqpencvpikpyklepddtalldlipfleyvarnspADIRAVLASYEKKDIAKEFLERSKDYQRRMQEQRQHNKSFWRR
mssnvvrpriFQILSkisnrncskyrrgfssdtvsgapkkepiiasqsivgDISAPPEVEAAEeaaapnevrkssWRFLTYGIVATLTGVTAGAGYLTYAYSTDEIEEKTRSLRESvnytagddtsaseKYQGLLYSAAMTVPAKAVEIYLDLRRLIEEQVRGFTeptsdkllpdLHPAEQHVFTLVLDLNETLLysdwkrdrgwrtFKRPGVDAFLEHMAKFYEIVVYSDQLNMYVDPVCERLDTNHCIRYrlsrgatkyqdgkhyrdlsklnrdPAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIRAVLASYEKKDIAKEFLERSKDYQRRMqeqrqhnksfwrr
MSSNVVRPRIFQILSKISNRNCSKYRRGFSSDTVSGAPKKEPIIASQSIVGDISappeveaaeeaaapnevRKSSWRFLTYGIVATLTGVTAGAGYLTYAYSTDEIEEKTRSLRESVNYTAGDDTSASEKYQGLLYSAAMTVPAKAVEIYLDLRRLIEEQVRGFTEPTSDKLLPDLHPAEQHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVYSDQLNMYVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIRAVLASYEKKDIAKEFLERSKDYQRRMQEQRQHNKSFWRR
********RIFQILSKIS********************************************************SWRFLTYGIVATLTGVTAGAGYLTYAYSTDEI***********************KYQGLLYSAAMTVPAKAVEIYLDLRRLIEEQVRGFTEPTSDKLLPDLHPAEQHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVYSDQLNMYVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIRAVLASYEKKDI****************************
*********************************************************************************GIVATLTGVTAGAGYLTY***********************************LYSAAMTVPAKAVEIYLDLRRLIEEQVRGFTEPTSDKLLPDLHPAEQHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVYSDQLNMYVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIRAVLASYEKKDIAKEF************************
MSSNVVRPRIFQILSKISNRNCSKYRRGFSSDTVSGAPKKEPIIASQSIVGDISAPPE************VRKSSWRFLTYGIVATLTGVTAGAGYLTYAYSTDEIEEKTRSLRESVNYTAGDDTSASEKYQGLLYSAAMTVPAKAVEIYLDLRRLIEEQVRGFTEPTSDKLLPDLHPAEQHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVYSDQLNMYVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIRAVLASYEKKDIAKEFLERSKDYQ****************
***NVVRPRIFQILSKISNRNCSKYRRGFS***V**************************************KSSWRFLTYGIVATLTGVTAGAGYLTYAYSTDEIEE*****************SASEKYQGLLYSAAMTVPAKAVEIYLDLRRLIEEQVRGFTEPTSDKLLPDLHPAEQHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVYSDQLNMYVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIRAVLASYEKKDIAKEFLERSKDYQRRMQEQRQH****W**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSNVVRPRIFQILSKISNRNCSKYRRGFSSDTVSGAPKKEPIIASQSIVGDISAPPEVEAAEEAAAPNEVRKSSWRFLTYGIVATLTGVTAGAGYLTYAYSTDEIEEKTRSLRESVNYTAGDDTSASEKYQGLLYSAAMTVPAKAVEIYLDLRRLIEEQVRGFTEPTSDKLLPDLHPAEQHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVYSDQLNMYVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIRAVLASYEKKDIxxxxxxxxxxxxxxxxxxxxxNKSFWRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query370 2.2.26 [Sep-21-2011]
Q8VYE2376 Mitochondrial import inne yes no 0.986 0.970 0.587 1e-124
Q5B4P0532 Mitochondrial import inne yes no 0.532 0.370 0.406 1e-39
Q4WI16501 Mitochondrial import inne no no 0.508 0.375 0.414 2e-38
Q4I099 525 Mitochondrial import inne yes no 0.564 0.398 0.377 4e-38
Q874C1 540 Mitochondrial import inne N/A no 0.502 0.344 0.397 3e-37
Q6BVY9471 Mitochondrial import inne yes no 0.705 0.554 0.331 5e-37
Q5S7T7409 Mitochondrial import inne N/A no 0.572 0.518 0.383 5e-37
Q02776476 Mitochondrial import inne yes no 0.448 0.348 0.449 3e-36
Q6FRX4485 Mitochondrial import inne yes no 0.505 0.385 0.408 9e-36
P0CN66516 Mitochondrial import inne yes no 0.437 0.313 0.429 2e-35
>sp|Q8VYE2|TIM50_ARATH Mitochondrial import inner membrane translocase subunit TIM50 OS=Arabidopsis thaliana GN=TIM50 PE=1 SV=1 Back     alignment and function desciption
 Score =  445 bits (1145), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 224/381 (58%), Positives = 281/381 (73%), Gaps = 16/381 (4%)

Query: 1   MSSNVVRPRIFQILSKISNRNCSKYRRGFSSD--TVSGAPKKEPIIASQSIVGDISAPPE 58
           M+S V+R R+   L+K+ +RN     R FS++  + +   +   + ++QS+  D   P +
Sbjct: 1   MASIVLRSRLLPRLAKLRSRNL----RCFSAEASSTNSTSRYSGVTSTQSMFSDFPPPNQ 56

Query: 59  VEAAEEAAAPNEV------RKSSWRFLTYGIVATLTGVTAGAGYLTYAYSTDEIEEKTRS 112
                               +   ++L Y ++  LTG TA  GY ++AY+ DE+ EKT++
Sbjct: 57  PPPPPPPQVEAAAAAATGKERKGLKYLGYALLWALTGATAATGYASFAYTIDEVNEKTKA 116

Query: 113 LRESVNYTAGDDTSASE---KYQGLLYSAAMTVPAKAVEIYLDLRRLIEEQVRGFTEPTS 169
            RES   T    +S  +   KYQ  LYSAAMT  A+A++ YL+LR ++EEQV+GFTEP S
Sbjct: 117 FRESATKTPVIKSSGIDVIDKYQTKLYSAAMTGSARAIDKYLELREIVEEQVKGFTEPLS 176

Query: 170 DKLLPDLHPAEQHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVY 229
           +KLLPDLHPAEQHVFTLVLDLNETLLY+DWKR+RGWRTFKRPGVDAFLEH+ KFYEIVVY
Sbjct: 177 EKLLPDLHPAEQHVFTLVLDLNETLLYTDWKRERGWRTFKRPGVDAFLEHLGKFYEIVVY 236

Query: 230 SDQLNMYVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFE 289
           SDQ+ MYV PVCE+LD N  IRY+L+RGATKY++GKHYRDLSKLNRDP KIL+VS +AFE
Sbjct: 237 SDQMEMYVLPVCEKLDPNGYIRYKLARGATKYENGKHYRDLSKLNRDPKKILFVSANAFE 296

Query: 290 SSLQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIRAVLASYEKKDIAKEFLER 349
           S+LQPEN VPIKPYKLE DDTAL+DLIPFLEYVARNSPADIR VLAS+E+KDIAKEF++R
Sbjct: 297 STLQPENSVPIKPYKLEADDTALVDLIPFLEYVARNSPADIRPVLASFERKDIAKEFIDR 356

Query: 350 SKDYQRRMQEQRQHNKSFWRR 370
           S +YQ+R Q Q    + FWRR
Sbjct: 357 SIEYQKRKQGQLGQGR-FWRR 376
Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5B4P0|TIM50_EMENI Mitochondrial import inner membrane translocase subunit tim50 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tim50 PE=3 SV=1 Back     alignment and function description
>sp|Q4WI16|TIM50_ASPFU Mitochondrial import inner membrane translocase subunit tim50 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim50 PE=3 SV=2 Back     alignment and function description
>sp|Q4I099|TIM50_GIBZE Mitochondrial import inner membrane translocase subunit TIM50 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM50 PE=3 SV=1 Back     alignment and function description
>sp|Q874C1|TIM50_NEUCR Mitochondrial import inner membrane translocase subunit tim-50 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim-50 PE=1 SV=1 Back     alignment and function description
>sp|Q6BVY9|TIM50_DEBHA Mitochondrial import inner membrane translocase subunit TIM50 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM50 PE=3 SV=1 Back     alignment and function description
>sp|Q5S7T7|TIM50_PHYIN Mitochondrial import inner membrane translocase subunit TIM50 OS=Phytophthora infestans GN=TIM50 PE=2 SV=1 Back     alignment and function description
>sp|Q02776|TIM50_YEAST Mitochondrial import inner membrane translocase subunit TIM50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM50 PE=1 SV=1 Back     alignment and function description
>sp|Q6FRX4|TIM50_CANGA Mitochondrial import inner membrane translocase subunit TIM50 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIM50 PE=3 SV=1 Back     alignment and function description
>sp|P0CN66|TIM50_CRYNJ Mitochondrial import inner membrane translocase subunit TIM50 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIM50 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query370
224114487361 predicted protein [Populus trichocarpa] 0.962 0.986 0.698 1e-141
225461886371 PREDICTED: mitochondrial import inner me 0.891 0.889 0.697 1e-135
224056445360 predicted protein [Populus trichocarpa] 0.916 0.941 0.689 1e-135
359485762362 PREDICTED: mitochondrial import inner me 0.935 0.955 0.697 1e-128
356552618333 PREDICTED: mitochondrial import inner me 0.791 0.879 0.715 1e-123
22330273376 mitochondrial import inner membrane tran 0.986 0.970 0.587 1e-122
363814420335 uncharacterized protein LOC100775411 [Gl 0.791 0.874 0.715 1e-122
334183363370 mitochondrial import inner membrane tran 0.970 0.970 0.580 1e-119
297847956376 hypothetical protein ARALYDRAFT_474659 [ 0.986 0.970 0.587 1e-118
8778307414 F14J16.15 [Arabidopsis thaliana] 0.948 0.847 0.584 1e-117
>gi|224114487|ref|XP_002316775.1| predicted protein [Populus trichocarpa] gi|222859840|gb|EEE97387.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  508 bits (1309), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 262/375 (69%), Positives = 298/375 (79%), Gaps = 19/375 (5%)

Query: 1   MSSNVVRPRIFQILSKISNRNCSKYRRGFSSDTVSGAPKKEPIIASQSIVGDISAPPEVE 60
           M+S V+R RI  I+S    RN    RR F S+       KEPII+SQS + D SA    E
Sbjct: 1   MASTVLRSRILSIVS----RNNKPNRRFFCSN-------KEPIISSQSTIPDQSAAAAEE 49

Query: 61  AAEEAAAPNEVRKSSWRFLTYGIVATLTGVTAGAGYLTYAYSTDEIEEKTRSLRESVNYT 120
           A  +AA   E    +W F  YGI+  LTG TA AGY +YAYS DE+EEKT++LRESVNYT
Sbjct: 50  APAQAAGIRE--NKAWNFFKYGIIGALTGATAFAGYASYAYSLDEVEEKTKTLRESVNYT 107

Query: 121 AGDDTSASEKYQGLLYSAAMTVPAKAVEIYLDLRRLIEEQVRGFTEPTSDKLLPDLHPAE 180
           A +D S  EKYQGLLYS  MTVPAKAVE+YLDLR+L+EE V+GFTEP SDKLLPDLHPAE
Sbjct: 108 ASNDASNVEKYQGLLYSTVMTVPAKAVELYLDLRKLLEEHVKGFTEPASDKLLPDLHPAE 167

Query: 181 QHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVYSDQLNMYVDPV 240
           QHVFTLVLDLNET++YSDWKRDRGWRTFKRPGVD FL+H+ +FYEIVVYSDQL+MYVDPV
Sbjct: 168 QHVFTLVLDLNETIIYSDWKRDRGWRTFKRPGVDDFLQHLGRFYEIVVYSDQLSMYVDPV 227

Query: 241 CERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPI 300
            ERLD NH IRYRLSR AT+YQDGKHYRDLSKLNRDP KILYVSGHAFE+SLQPENCVPI
Sbjct: 228 VERLDPNHFIRYRLSRSATRYQDGKHYRDLSKLNRDPGKILYVSGHAFENSLQPENCVPI 287

Query: 301 KPYKLE-----PDDTALLDLIPFLEYVARNSPADIRAVLASYEKKDIAKEFLERSKDYQR 355
           KP+K++     P DTALLDLIPFLEYVARNSP+DIR VLASYE+KD+ KEFLERSKDYQ 
Sbjct: 288 KPFKIDETGDVPLDTALLDLIPFLEYVARNSPSDIRTVLASYERKDLGKEFLERSKDYQ- 346

Query: 356 RMQEQRQHNKSFWRR 370
           R  ++++     WRR
Sbjct: 347 RRMQEQRQQGRLWRR 361

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225461886|ref|XP_002264515.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50 [Vitis vinifera] gi|296089900|emb|CBI39719.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224056445|ref|XP_002298860.1| predicted protein [Populus trichocarpa] gi|222846118|gb|EEE83665.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359485762|ref|XP_003633330.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Vitis vinifera] gi|296085020|emb|CBI28435.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356552618|ref|XP_003544661.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM50-like [Glycine max] Back     alignment and taxonomy information
>gi|22330273|ref|NP_175986.2| mitochondrial import inner membrane translocase subunit TIM50 [Arabidopsis thaliana] gi|75161466|sp|Q8VYE2.1|TIM50_ARATH RecName: Full=Mitochondrial import inner membrane translocase subunit TIM50; AltName: Full=Protein EMBRYO DEFECTIVE 1860; Flags: Precursor gi|18175981|gb|AAL59962.1| unknown protein [Arabidopsis thaliana] gi|21689895|gb|AAM67508.1| unknown protein [Arabidopsis thaliana] gi|332195195|gb|AEE33316.1| mitochondrial import inner membrane translocase subunit TIM50 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|363814420|ref|NP_001242847.1| uncharacterized protein LOC100775411 [Glycine max] gi|255638757|gb|ACU19683.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|334183363|ref|NP_001185246.1| mitochondrial import inner membrane translocase subunit TIM50 [Arabidopsis thaliana] gi|332195196|gb|AEE33317.1| mitochondrial import inner membrane translocase subunit TIM50 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297847956|ref|XP_002891859.1| hypothetical protein ARALYDRAFT_474659 [Arabidopsis lyrata subsp. lyrata] gi|297337701|gb|EFH68118.1| hypothetical protein ARALYDRAFT_474659 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|8778307|gb|AAF79316.1|AC002304_9 F14J16.15 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query370
TAIR|locus:2012010376 TIM50 "AT1G55900" [Arabidopsis 0.991 0.976 0.585 2.9e-112
CGD|CAL0001128469 TIM50 [Candida albicans (taxid 0.529 0.417 0.421 8.3e-39
UNIPROTKB|Q59W44469 TIM50 "Mitochondrial import in 0.529 0.417 0.421 8.3e-39
ASPGD|ASPL0000076049532 AN4490 [Emericella nidulans (t 0.532 0.370 0.406 1.6e-38
SGD|S000005984476 TIM50 "Essential component of 0.505 0.392 0.439 7e-38
UNIPROTKB|G4NF81 526 MGG_04219 "Mitochondrial impor 0.559 0.393 0.376 1.5e-37
UNIPROTKB|E2RC78356 TIMM50 "Uncharacterized protei 0.524 0.544 0.407 1.7e-34
UNIPROTKB|E2RFI6392 TIMM50 "Uncharacterized protei 0.524 0.494 0.407 1.7e-34
POMBASE|SPBC17A3.01c452 tim50 "TIM23 translocase compl 0.545 0.446 0.367 1.7e-34
UNIPROTKB|F6PR67355 TIMM50 "Mitochondrial import i 0.524 0.546 0.402 2.8e-34
TAIR|locus:2012010 TIM50 "AT1G55900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1108 (395.1 bits), Expect = 2.9e-112, P = 2.9e-112
 Identities = 222/379 (58%), Positives = 276/379 (72%)

Query:     1 MSSNVVRPRIFQILSKISNRNCSKYRRGFSSDTVSGAPKKEPIIASQSIVGDISXXXXX- 59
             M+S V+R R+   L+K+ +RN   +    SS   +   +   + ++QS+  D        
Sbjct:     1 MASIVLRSRLLPRLAKLRSRNLRCFSAEASS--TNSTSRYSGVTSTQSMFSDFPPPNQPP 58

Query:    60 -----XXXXXXXXXXXXRKSSWRFLTYGIVATLTGVTAGAGYLTYAYSTDEIEEKTRSLR 114
                               +   ++L Y ++  LTG TA  GY ++AY+ DE+ EKT++ R
Sbjct:    59 PPPPPQVEAAAAAATGKERKGLKYLGYALLWALTGATAATGYASFAYTIDEVNEKTKAFR 118

Query:   115 ESVNYTAGDDTSASE---KYQGLLYSAAMTVPAKAVEIYLDLRRLIEEQVRGFTEPTSDK 171
             ES   T    +S  +   KYQ  LYSAAMT  A+A++ YL+LR ++EEQV+GFTEP S+K
Sbjct:   119 ESATKTPVIKSSGIDVIDKYQTKLYSAAMTGSARAIDKYLELREIVEEQVKGFTEPLSEK 178

Query:   172 LLPDLHPAEQHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVYSD 231
             LLPDLHPAEQHVFTLVLDLNETLLY+DWKR+RGWRTFKRPGVDAFLEH+ KFYEIVVYSD
Sbjct:   179 LLPDLHPAEQHVFTLVLDLNETLLYTDWKRERGWRTFKRPGVDAFLEHLGKFYEIVVYSD 238

Query:   232 QLNMYVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESS 291
             Q+ MYV PVCE+LD N  IRY+L+RGATKY++GKHYRDLSKLNRDP KIL+VS +AFES+
Sbjct:   239 QMEMYVLPVCEKLDPNGYIRYKLARGATKYENGKHYRDLSKLNRDPKKILFVSANAFEST 298

Query:   292 LQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIRAVLASYEKKDIAKEFLERSK 351
             LQPEN VPIKPYKLE DDTAL+DLIPFLEYVARNSPADIR VLAS+E+KDIAKEF++RS 
Sbjct:   299 LQPENSVPIKPYKLEADDTALVDLIPFLEYVARNSPADIRPVLASFERKDIAKEFIDRSI 358

Query:   352 DYQRRMQEQRQHNKSFWRR 370
             +YQ+R Q Q    + FWRR
Sbjct:   359 EYQKRKQGQLGQGR-FWRR 376
GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0005743 "mitochondrial inner membrane" evidence=IDA
GO:0006626 "protein targeting to mitochondrion" evidence=RCA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
CGD|CAL0001128 TIM50 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59W44 TIM50 "Mitochondrial import inner membrane translocase subunit TIM50" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
ASPGD|ASPL0000076049 AN4490 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000005984 TIM50 "Essential component of the TIM23 complex" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G4NF81 MGG_04219 "Mitochondrial import inner membrane translocase subunit tim-50" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|E2RC78 TIMM50 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFI6 TIMM50 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
POMBASE|SPBC17A3.01c tim50 "TIM23 translocase complex subunit Tim50 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F6PR67 TIMM50 "Mitochondrial import inner membrane translocase subunit TIM50" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8VYE2TIM50_ARATHNo assigned EC number0.58790.98640.9707yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query370
pfam03031153 pfam03031, NIF, NLI interacting factor-like phosph 1e-43
smart00577148 smart00577, CPDc, catalytic domain of ctd-like pho 7e-41
TIGR02251162 TIGR02251, HIF-SF_euk, Dullard-like phosphatase do 2e-34
COG5190390 COG5190, FCP1, TFIIF-interacting CTD phosphatases, 2e-23
>gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase Back     alignment and domain information 
 Score =  147 bits (374), Expect = 1e-43
 Identities = 60/159 (37%), Positives = 94/159 (59%), Gaps = 17/159 (10%)

Query: 184 FTLVLDLNETLLYSDWKRD----------RGWRTFKRPGVDAFLEHMAKFYEIVVYSDQL 233
            TLVLDL+ETL++S ++ D           G    KRPG+D FL+ ++K+YEIV+++   
Sbjct: 1   KTLVLDLDETLVHSSFEPDLPFDFVLNFNHGVYVKKRPGLDEFLQELSKYYEIVIFTASS 60

Query: 234 NMYVDPVCERLDTNHC-IRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSL 292
             Y DPV ++LD      ++RL R +  +    + +DLS L RD ++++ V        L
Sbjct: 61  KEYADPVLDKLDPKKKYFKHRLYRESCTF----YVKDLSLLGRDLSRVVIVDNSPRSFLL 116

Query: 293 QPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIR 331
           QP+N +PI P+  +PDDT LL L+PFL+ +A+    D+R
Sbjct: 117 QPDNGIPIPPFYGDPDDTELLKLLPFLKELAKVD--DVR 153

This family contains a number of NLI interacting factor isoforms and also an N-terminal regions of RNA polymerase II CTC phosphatase and FCP1 serine phosphatase. This region has been identified as the minimal phosphatase domain. Length = 153
>gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases Back     alignment and domain information
>gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain Back     alignment and domain information
>gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 370
KOG2832393 consensus TFIIF-interacting CTD phosphatase, inclu 100.0
KOG1605262 consensus TFIIF-interacting CTD phosphatase, inclu 100.0
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 100.0
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 100.0
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 100.0
COG5190390 FCP1 TFIIF-interacting CTD phosphatases, including 99.96
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 99.96
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.92
KOG0323 635 consensus TFIIF-interacting CTD phosphatases, incl 99.56
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.37
COG5190390 FCP1 TFIIF-interacting CTD phosphatases, including 98.18
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 98.17
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 98.01
TIGR01684301 viral_ppase viral phosphatase. These proteins also 97.96
PHA03398303 viral phosphatase superfamily protein; Provisional 97.94
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 97.79
PHA02530300 pseT polynucleotide kinase; Provisional 97.69
PRK13288214 pyrophosphatase PpaX; Provisional 97.67
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 97.61
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 97.56
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 97.55
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 97.51
PRK13222226 phosphoglycolate phosphatase; Provisional 97.44
PRK13226229 phosphoglycolate phosphatase; Provisional 97.43
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 97.41
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 97.41
PRK13223272 phosphoglycolate phosphatase; Provisional 97.41
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 97.36
PRK11587218 putative phosphatase; Provisional 97.32
PHA02597197 30.2 hypothetical protein; Provisional 97.31
PRK14988224 GMP/IMP nucleotidase; Provisional 97.29
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 97.26
PRK13225273 phosphoglycolate phosphatase; Provisional 97.25
COG0637221 Predicted phosphatase/phosphohexomutase [General f 97.14
PLN02575381 haloacid dehalogenase-like hydrolase 97.14
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 97.06
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 97.03
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 97.01
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 96.98
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 96.97
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 96.88
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 96.82
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 96.8
PRK13582205 thrH phosphoserine phosphatase; Provisional 96.8
PRK06769173 hypothetical protein; Validated 96.8
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 96.73
PLN02940 382 riboflavin kinase 96.72
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 96.64
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 96.45
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 96.35
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 96.35
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 96.21
COG4996164 Predicted phosphatase [General function prediction 96.19
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 96.19
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 96.15
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 96.02
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 95.97
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 95.94
PRK08238 479 hypothetical protein; Validated 95.91
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 95.81
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 95.65
PRK11133322 serB phosphoserine phosphatase; Provisional 95.6
PRK09449224 dUMP phosphatase; Provisional 95.51
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 95.38
COG0546220 Gph Predicted phosphatases [General function predi 95.19
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 95.16
PLN02770248 haloacid dehalogenase-like hydrolase family protei 95.08
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 94.99
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 94.96
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 94.94
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 94.93
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 94.91
PLN02954224 phosphoserine phosphatase 94.72
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 94.6
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 94.51
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 94.38
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 94.36
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 94.0
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 93.83
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 93.45
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 93.2
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 92.96
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 92.89
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 92.88
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 92.73
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 92.58
PRK10563221 6-phosphogluconate phosphatase; Provisional 91.94
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 91.91
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 91.73
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 91.23
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 91.08
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 90.75
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 90.64
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 90.63
PLN02779286 haloacid dehalogenase-like hydrolase family protei 90.52
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 90.3
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 90.27
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 90.1
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 89.94
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 89.92
PTZ00445219 p36-lilke protein; Provisional 89.88
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 89.47
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 89.25
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 89.23
PLN02645 311 phosphoglycolate phosphatase 89.19
PRK10513270 sugar phosphate phosphatase; Provisional 88.97
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 88.9
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 88.57
COG0241181 HisB Histidinol phosphatase and related phosphatas 88.38
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 88.35
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 88.32
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 88.18
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 88.15
PRK10444248 UMP phosphatase; Provisional 87.86
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 87.51
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 87.35
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 87.12
PRK01158230 phosphoglycolate phosphatase; Provisional 86.55
PLN02811220 hydrolase 86.32
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 86.02
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 85.95
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 85.95
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 85.52
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 85.4
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 85.21
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 84.37
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 82.48
PRK10976266 putative hydrolase; Provisional 82.14
PLN02423245 phosphomannomutase 81.94
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 81.65
COG2503274 Predicted secreted acid phosphatase [General funct 81.05
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 80.37
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 80.21
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 80.06
>KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=8.6e-63  Score=483.59  Aligned_cols=263  Identities=41%  Similarity=0.636  Sum_probs=232.6

Q ss_pred             hhhhhHHHHHHHHHHHHhhhhcceeeEEEecCCchHHHHhhhhhhccCCCCCCCCchhHHHHHHHHhhhccchhHHHHHH
Q 047655           71 VRKSSWRFLTYGIVATLTGVTAGAGYLTYAYSTDEIEEKTRSLRESVNYTAGDDTSASEKYQGLLYSAAMTVPAKAVEIY  150 (370)
Q Consensus        71 ~~~~~~~~~~~~~~~~~~g~~~~~~y~~~~~~~~e~d~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~p~~~~~~y  150 (370)
                      ..+++|+.++..+..++++++++.  ++|-++.++.||.+         +|.|++|.  .++               +.|
T Consensus       103 e~~~~~rr~~~~f~~~~~s~~s~~--a~y~~g~~~~de~G---------~i~ddfs~--~l~---------------~~~  154 (393)
T KOG2832|consen  103 ELRRAFRRMKLKFPVFGGSAVSIS--AIYLTGEPSRDEKG---------KIIDDFSN--YLV---------------QYL  154 (393)
T ss_pred             hhhHHHHhhhcceeeecccceeEE--EEEEecCCccccCC---------CcchhHHH--HHH---------------HHH
Confidence            346677777755554433333333  66777777777654         36677774  232               345


Q ss_pred             HHHHHHHHHHhccCCCCCCCCCCCC--CCCCCCCceEEEEeCCCceeccccCCCCceeeeeCccHHHHHHHHHhcccEEE
Q 047655          151 LDLRRLIEEQVRGFTEPTSDKLLPD--LHPAEQHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVV  228 (370)
Q Consensus       151 ~~~r~~~~~~~~~f~eP~~~~LLP~--~~P~~~~k~TLVLDLDeTLVhs~~~~~~G~~v~kRPgld~FL~~Ls~~YEIVI  228 (370)
                      .|+++.++++.++|+||.+.+||||  ++|+.|+++||||||+++|||.+|+..+||+++||||+|+||.+|+++|||||
T Consensus       155 ~R~~~~~~~~~~~~~EP~~~~LLPdpl~pPy~Qp~yTLVleledvLVhpdws~~tGwRf~kRPgvD~FL~~~a~~yEIVi  234 (393)
T KOG2832|consen  155 RRVWKIFNSYERMFKEPDRAKLLPDPLPPPYEQPPYTLVLELEDVLVHPDWSYKTGWRFKKRPGVDYFLGHLAKYYEIVV  234 (393)
T ss_pred             HHHHHHHHhHHHHhcCCchhhhCCCCCCCcccCCCceEEEEeeeeEeccchhhhcCceeccCchHHHHHHhhcccceEEE
Confidence            5788899999999999999999999  56677999999999999999999999999999999999999999999999999


Q ss_pred             eccCchhcHHHHHhhcCCCcceeEEEecCcccccCCccccccccCCCCCCcEEEEeCCCccccCCCCccccCCCCCCCCC
Q 047655          229 YSDQLNMYVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPIKPYKLEPD  308 (370)
Q Consensus       229 fTs~~~~YA~~Il~~LDP~~~i~~rL~Re~c~~~~G~~iKDLs~LgRDls~VIiIDd~~~~~~~qpeN~I~I~~w~gd~~  308 (370)
                      ||+++.+|+.+|++.|||+|||+|+|||++|.+.+|+|+|||++||||+++||+||.++.++.+||+|.|++++|.|+++
T Consensus       235 ~sse~gmt~~pl~d~lDP~g~IsYkLfr~~t~y~~G~HvKdls~LNRdl~kVivVd~d~~~~~l~P~N~l~l~~W~Gn~d  314 (393)
T KOG2832|consen  235 YSSEQGMTVFPLLDALDPKGYISYKLFRGATKYEEGHHVKDLSKLNRDLQKVIVVDFDANSYKLQPENMLPLEPWSGNDD  314 (393)
T ss_pred             EecCCccchhhhHhhcCCcceEEEEEecCcccccCccchhhhhhhccccceeEEEEccccccccCcccccccCcCCCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ChHHhhhHHHHHHHHhCCCCcHHHHHHhhcC-CChHHHHHHHHHHHHHHHHHHH
Q 047655          309 DTALLDLIPFLEYVARNSPADIRAVLASYEK-KDIAKEFLERSKDYQRRMQEQR  361 (370)
Q Consensus       309 D~eLl~LipfLe~La~~~v~DVR~vL~sy~~-~di~~ef~~r~~~~~~~~~~~~  361 (370)
                      |+.|++|++||+.||+++++|||++|.+|.+ +|..++|.+|++.+++++.++.
T Consensus       315 Dt~L~dL~~FL~~ia~~~~eDvR~vL~~y~~~~D~~~~F~~rqk~l~eq~~~~~  368 (393)
T KOG2832|consen  315 DTSLFDLLAFLEYIAQQQVEDVRPVLQSYSQEKDPAKEFRDRQKKLQEQQYESE  368 (393)
T ss_pred             cchhhhHHHHHHHHHHccHHHHHHHHHHhccccCHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999 6788999999988887666554

>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query370
3qle_A204 Structural Basis For The Function Of Tim50 In The M 9e-37
2hhl_A195 Crystal Structure Of The Human Small Ctd Phosphatas 3e-20
2q5e_A187 Crystal Structure Of Human Carboxy-Terminal Domain 2e-18
3l0c_A184 Crystal Structure Of Scp1 Phosphatase D206a Mutant 2e-18
3pgl_A180 Crystal Structure Of Human Small C-Terminal Domain 5e-18
3l0y_A184 Crystal Structure Of Scp1 Phosphatase D98a Mutant L 7e-18
3l0b_A184 Crystal Structure Of Scp1 Phosphatase D206a Mutant 1e-17
2ghq_A181 Ctd-Specific Phosphatase Scp1 In Complex With Pepti 2e-17
1t9z_A197 Three-Dimensional Structure Of A Rna-Polymerase Ii 2e-17
1ta0_A197 Three-Dimensional Structure Of A Rna-Polymerase Ii 3e-17
>pdb|3QLE|A Chain A, Structural Basis For The Function Of Tim50 In The Mitochondrial Presequence Translocase Length = 204 Back     alignment and structure 
Iteration: 1

 Score =  150 bits (380), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 111/169 (65%), Gaps = 3/169 (1%)
Query: 185 TLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVYSDQLNMYVDPVCERL 244
           TLV+ L + L++S+W +  GWRT KRPG D FL +++++YEIV++S    MY D + E+L
Sbjct: 36  TLVITLEDFLVHSEWSQKHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKL 95
Query: 245 DTNHC-IRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPIKPY 303
           D  H  + Y L +    Y+DG H +DLSKLNRD +K++ +        LQPEN +P++P+
Sbjct: 96  DPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPW 155
Query: 304 KLEPDDTALLDLIPFLEYVARNSPADIRAVLASYE-KKDIAKEFLERSK 351
             E DD  L+ LIPFLEY+A     D+R +L S+E KK++A+EF  R K
Sbjct: 156 NGEADD-KLVRLIPFLEYLATQQTKDVRPILNSFEDKKNLAEEFDHRVK 203
>pdb|2HHL|A Chain A, Crystal Structure Of The Human Small Ctd Phosphatase 3 Isoform 1 Length = 195 Back     alignment and structure
>pdb|2Q5E|A Chain A, Crystal Structure Of Human Carboxy-Terminal Domain Rna Polymerase Ii Polypeptide A Small Phosphatase 2 Length = 187 Back     alignment and structure
>pdb|3L0C|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant With Trap Inorganic Phosphate Length = 184 Back     alignment and structure
>pdb|3PGL|A Chain A, Crystal Structure Of Human Small C-Terminal Domain Phosphatase 1 (Scp1) Bound To Rabeprazole Length = 180 Back     alignment and structure
>pdb|3L0Y|A Chain A, Crystal Structure Of Scp1 Phosphatase D98a Mutant Length = 184 Back     alignment and structure
>pdb|3L0B|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant Phosphory Intermediate Length = 184 Back     alignment and structure
>pdb|2GHQ|A Chain A, Ctd-Specific Phosphatase Scp1 In Complex With Peptide C- Terminal Domain Of Rna Polymerase Ii Length = 181 Back     alignment and structure
>pdb|1T9Z|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein Length = 197 Back     alignment and structure
>pdb|1TA0|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein With Associated Ligand Length = 197 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query370
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 6e-77
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 2e-66
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 9e-64
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 2e-38
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 1e-16
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 Back     alignment and structure
 Score =  234 bits (600), Expect = 6e-77
 Identities = 84/202 (41%), Positives = 119/202 (58%), Gaps = 4/202 (1%)

Query: 153 LRRLIEEQVRGFTEPTSDKLLPDLHPAE-QHVFTLVLDLNETLLYSDWKRDRGWRTFKRP 211
                      F EP    LLP   P   Q   TLV+ L + L++S+W +  GWRT KRP
Sbjct: 3   SHASFNSMFTYFQEPPFPDLLPPPPPPPYQRPLTLVITLEDFLVHSEWSQKHGWRTAKRP 62

Query: 212 GVDAFLEHMAKFYEIVVYSDQLNMYVDPVCERLDTNH-CIRYRLSRGATKYQDGKHYRDL 270
           G D FL +++++YEIV++S    MY D + E+LD  H  + Y L +    Y+DG H +DL
Sbjct: 63  GADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDL 122

Query: 271 SKLNRDPAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADI 330
           SKLNRD +K++ +        LQPEN +P++P+  E DD  L+ LIPFLEY+A     D+
Sbjct: 123 SKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADDK-LVRLIPFLEYLATQQTKDV 181

Query: 331 RAVLASYE-KKDIAKEFLERSK 351
           R +L S+E KK++A+EF  R K
Sbjct: 182 RPILNSFEDKKNLAEEFDHRVK 203
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query370
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 100.0
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 100.0
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 100.0
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 100.0
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 99.97
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 99.97
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 98.21
3ib6_A189 Uncharacterized protein; structural genomics, unkn 98.19
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 98.11
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.05
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 97.99
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 97.99
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 97.96
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 97.9
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 97.79
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 97.79
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 97.78
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 97.76
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 97.76
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 97.75
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 97.75
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 97.7
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 97.68
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 97.67
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 97.67
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 97.63
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 97.63
3sd7_A240 Putative phosphatase; structural genomics, haloaci 97.59
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 97.58
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 97.53
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 97.53
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 97.52
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 97.49
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 97.46
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 97.41
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 97.4
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 97.4
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 97.37
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 97.37
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 97.28
2o2x_A218 Hypothetical protein; structural genomics, joint c 97.26
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 97.26
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 97.25
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 97.22
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 97.22
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 97.2
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 97.18
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 97.16
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 97.14
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 97.12
3fvv_A232 Uncharacterized protein; unknown function, structu 97.11
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 97.11
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 97.07
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 97.02
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 97.0
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 97.0
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 97.0
3mn1_A189 Probable YRBI family phosphatase; structural genom 96.96
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 96.93
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 96.85
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 96.81
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 96.79
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 96.78
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 96.78
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 96.72
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 96.68
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 96.64
3mmz_A176 Putative HAD family hydrolase; structural genomics 96.5
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 96.5
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 96.48
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 96.42
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 96.41
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 96.35
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 96.3
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 96.28
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 96.08
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 96.08
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 96.08
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 95.82
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 95.8
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 95.79
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 95.68
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 95.49
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 95.34
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 95.29
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 95.27
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 95.14
2hsz_A243 Novel predicted phosphatase; structural genomics, 94.97
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 94.72
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 94.4
1te2_A226 Putative phosphatase; structural genomics, phospha 94.29
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 94.06
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 93.95
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 93.9
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 93.74
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 93.48
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 93.47
2zg6_A220 Putative uncharacterized protein ST2620, probable 93.45
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 92.88
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 92.53
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 92.26
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 92.07
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 92.01
1l6r_A227 Hypothetical protein TA0175; structural genomics, 91.97
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 91.06
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 91.04
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 91.02
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 90.83
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 90.8
2p11_A231 Hypothetical protein; putative haloacid dehalogena 90.66
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 90.53
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 90.53
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 90.47
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 90.31
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 90.07
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 90.03
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 90.01
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 89.68
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 89.67
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 89.62
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 89.56
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 89.52
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 88.92
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 88.8
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 88.54
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 88.27
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 87.99
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 87.7
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 87.2
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 87.04
3dao_A283 Putative phosphatse; structural genomics, joint ce 86.88
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 86.81
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 86.54
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 86.32
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 86.08
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 85.5
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 84.86
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 84.54
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 84.45
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 84.15
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 83.79
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 83.68
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 83.64
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 83.62
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 83.7
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 82.74
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 81.16
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 80.93
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
Probab=100.00  E-value=1.3e-57  Score=421.02  Aligned_cols=197  Identities=42%  Similarity=0.742  Sum_probs=172.2

Q ss_pred             HHHHHHHhccCCCCCCCCCCCCCCC-CCCCceEEEEeCCCceeccccCCCCceeeeeCccHHHHHHHHHhcccEEEeccC
Q 047655          154 RRLIEEQVRGFTEPTSDKLLPDLHP-AEQHVFTLVLDLNETLLYSDWKRDRGWRTFKRPGVDAFLEHMAKFYEIVVYSDQ  232 (370)
Q Consensus       154 r~~~~~~~~~f~eP~~~~LLP~~~P-~~~~k~TLVLDLDeTLVhs~~~~~~G~~v~kRPgld~FL~~Ls~~YEIVIfTs~  232 (370)
                      +.++.+.+.+|++|.+++|||++.| ..++++||||||||||||+.|++.+||++.+|||+++||++|+++|||||||++
T Consensus         4 ~~~~~~~~~~~~~p~~~~lLp~~~~~~~~~~~tLVLDLDeTLvh~~~~~~~~~~v~~RPgl~eFL~~l~~~yeivI~Tas   83 (204)
T 3qle_A            4 HASFNSMFTYFQEPPFPDLLPPPPPPPYQRPLTLVITLEDFLVHSEWSQKHGWRTAKRPGADYFLGYLSQYYEIVLFSSN   83 (204)
T ss_dssp             ---------------CCCCSCCCC----CCSEEEEEECBTTTEEEEEETTTEEEEEECTTHHHHHHHHTTTEEEEEECSS
T ss_pred             hhHHHHHHHhhcCCCcccCCCCCCccccCCCeEEEEeccccEEeeeccccCceeEEeCCCHHHHHHHHHhCCEEEEEcCC
Confidence            3467788899999999999999986 458999999999999999999999999999999999999999999999999999


Q ss_pred             chhcHHHHHhhcCCCc-ceeEEEecCcccccCCccccccccCCCCCCcEEEEeCCCccccCCCCccccCCCCCCCCCChH
Q 047655          233 LNMYVDPVCERLDTNH-CIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTA  311 (370)
Q Consensus       233 ~~~YA~~Il~~LDP~~-~i~~rL~Re~c~~~~G~~iKDLs~LgRDls~VIiIDd~~~~~~~qpeN~I~I~~w~gd~~D~e  311 (370)
                      .+.||++|++.|||.+ +|.++|+|++|.+.+|.|+|||++||||+++||||||++.+|.+||+|+|+|++|.|++ |++
T Consensus        84 ~~~ya~~vl~~LDp~~~~f~~rl~R~~c~~~~g~y~KdL~~Lgrdl~~vIiIDDsp~~~~~~p~N~I~I~~~~~~~-D~e  162 (204)
T 3qle_A           84 YMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEA-DDK  162 (204)
T ss_dssp             CHHHHHHHHHHTSTTCSSEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEEESCTTTTTTCGGGEEECCCCCSSC-CCH
T ss_pred             cHHHHHHHHHHhCCCCCeEEEEEEecceeEECCeeeecHHHhCCChHHEEEEECCHHHHhhCccCceEeeeECCCC-Chh
Confidence            9999999999999985 89999999999999999999999999999999999999999999999999999999976 558


Q ss_pred             HhhhHHHHHHHHhCCCCcHHHHHHhhcC-CChHHHHHHHHH
Q 047655          312 LLDLIPFLEYVARNSPADIRAVLASYEK-KDIAKEFLERSK  351 (370)
Q Consensus       312 Ll~LipfLe~La~~~v~DVR~vL~sy~~-~di~~ef~~r~~  351 (370)
                      |++|+|||+.|+.++++|||++|++|++ +|||+||.+|++
T Consensus       163 L~~L~~~L~~L~~~~~~DVR~~L~~~~~~~~~~~~f~~~~~  203 (204)
T 3qle_A          163 LVRLIPFLEYLATQQTKDVRPILNSFEDKKNLAEEFDHRVK  203 (204)
T ss_dssp             HHHHHHHHHHHHHTCCSCSHHHHTTSSCGGGHHHHHHHHCC
T ss_pred             HHHHHHHHHHHhhcChHHHHHHHHHhcCCCCHHHHHHHhhc
Confidence            9999999999998789999999999998 599999999863
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 370
d1ta0a_181 c.108.1.16 (A:) Carboxy-terminal domain RNA polyme 9e-47
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  155 bits (393), Expect = 9e-47
 Identities = 56/178 (31%), Positives = 87/178 (48%), Gaps = 17/178 (9%)

Query: 172 LLPDLHPAEQHVFTLVLDLNETLLYSDWKRDRG---------------WRTFKRPGVDAF 216
           LLP+    +     +V+DL+ETL++S +K                       KRP VD F
Sbjct: 4   LLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEF 63

Query: 217 LEHMAKFYEIVVYSDQLNMYVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRD 276
           L+ M + +E V+++  L  Y DPV + LD     R RL R +  +  G + +DLS+L RD
Sbjct: 64  LQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRD 123

Query: 277 PAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTALLDLIPFLEYVARNSPADIRAVL 334
             ++L +          P+N VP+  +     DT L DL+PF E ++R    D+ +VL
Sbjct: 124 LRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSR--VDDVYSVL 179

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query370
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 100.0
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 98.38
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 98.17
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 98.04
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 98.01
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 97.95
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 97.88
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 97.85
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 97.67
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.56
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 97.54
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 97.36
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 97.28
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 97.23
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 97.19
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 97.08
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 97.0
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 96.98
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 96.97
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 96.86
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 96.69
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 96.31
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 96.21
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 96.03
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 95.9
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 95.7
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 95.52
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 95.39
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 95.36
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 93.72
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 93.47
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 93.42
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 93.1
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 92.7
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 92.39
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 92.11
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 91.93
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 91.46
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 91.21
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 90.79
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 90.61
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 90.14
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 90.07
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 90.02
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 89.61
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 89.41
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 88.64
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 87.53
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 82.45
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8.4e-48  Score=345.10  Aligned_cols=163  Identities=34%  Similarity=0.586  Sum_probs=154.9

Q ss_pred             CCCCCCCCCCCCceEEEEeCCCceeccccCCC---------------CceeeeeCccHHHHHHHHHhcccEEEeccCchh
Q 047655          171 KLLPDLHPAEQHVFTLVLDLNETLLYSDWKRD---------------RGWRTFKRPGVDAFLEHMAKFYEIVVYSDQLNM  235 (370)
Q Consensus       171 ~LLP~~~P~~~~k~TLVLDLDeTLVhs~~~~~---------------~G~~v~kRPgld~FL~~Ls~~YEIVIfTs~~~~  235 (370)
                      .|||++.|..++|+||||||||||||+...+.               .++++++|||+++||++|+++|||+|||++.+.
T Consensus         3 ~llp~~~~~~~~k~~LVLDLDeTLihs~~~~~~~~~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~Ta~~~~   82 (181)
T d1ta0a_           3 YLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAK   82 (181)
T ss_dssp             CSSCCCCGGGTTSCEEEECCBTTTEEEESSCCTTCSEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEECSSCHH
T ss_pred             ccCCCCCcccCCCeEEEEeCCCCEEccccCCCCCccceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEEcCCcHH
Confidence            47899999899999999999999999987543               236789999999999999999999999999999


Q ss_pred             cHHHHHhhcCCCcceeEEEecCcccccCCccccccccCCCCCCcEEEEeCCCccccCCCCccccCCCCCCCCCChHHhhh
Q 047655          236 YVDPVCERLDTNHCIRYRLSRGATKYQDGKHYRDLSKLNRDPAKILYVSGHAFESSLQPENCVPIKPYKLEPDDTALLDL  315 (370)
Q Consensus       236 YA~~Il~~LDP~~~i~~rL~Re~c~~~~G~~iKDLs~LgRDls~VIiIDd~~~~~~~qpeN~I~I~~w~gd~~D~eLl~L  315 (370)
                      ||++|++.|||++.+.++++|++|...++.++|||+++||++++||||||++.+|..||+|+|+|++|.|+++|++|..|
T Consensus        83 YA~~il~~ldp~~~~~~~~~r~~c~~~~~~~~KdL~~l~~~l~~vvivDd~~~~~~~~~~N~I~I~~f~~~~~D~eL~~l  162 (181)
T d1ta0a_          83 YADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDL  162 (181)
T ss_dssp             HHHHHHHHHCSSCCEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEECSCGGGGTTCGGGBCCCCCCSSCTTCCHHHHH
T ss_pred             HHHHHHHHhccCCceeEEEEeeeeeecCCcccccHhhcCCCHHHeEEEcCChhhhhcCccCeeEecCcCCCCCcHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCCcHHHHHH
Q 047655          316 IPFLEYVARNSPADIRAVLA  335 (370)
Q Consensus       316 ipfLe~La~~~v~DVR~vL~  335 (370)
                      ++||+.|+.  ++|||++|+
T Consensus       163 ~~~L~~l~~--~~DVR~~l~  180 (181)
T d1ta0a_         163 LPFFEQLSR--VDDVYSVLR  180 (181)
T ss_dssp             HHHHHHHTT--CSCHHHHHC
T ss_pred             HHHHHHHcc--CCcHHHHhc
Confidence            999999987  799999996
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure