Citrus Sinensis ID: 047688


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MYIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCSSHILKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQPRWDYWG
cEEEEEEcccccEEEEEEcccccccccccEEEEEcccccccEEEEEEEEEEEEEccccccccEEEEEEEEEEEcccccccEEEEEcccccccccccEEEEEcccccccccccEEEEEEEEccccccHHHHHHHHHHccccEEEEEcccccccEEEcccccccccccccccccccccccccccccc
cEEEEEEEEEcccccccccccccccccccEEEEEccccccEEEEEEEEEEEEEEcccEEEccccEEEEEEEEEcccccccEEEEEEccccccccccEEEEEcccccccccccEEEEEEEccccccccHHHHHHHHHccccEEEEEcccHHHHHHccccccccccccccccccccccccccccccc
MYIVWINEFAgefqignnikslnpksvtSVVRYGTLRSQLNRRATCHSlvsnqlypffrpsklhlwnhtqcsshilkpdtlyyyqcgdpsipamsgtyyfrtmpdssptsypsriaiVGDVGLTYNTTSTVshmisnrpdlILLVGDVTYANLyltngtgfdcyscsfanspiyetyqprwdywg
MYIVWINEFAGEfqignnikslnpksVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCSSHILKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFanspiyetyqprwDYWG
MYIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCSSHILKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQPRWDYWG
*YIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCSSHILKPDTLYYYQCGDPSIPAMSGTYYFRTM*******YPSRIAIVGDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQPRWDYW*
MYIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCSSHILKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQPRWDYWG
MYIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCSSHILKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQPRWDYWG
MYIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCSSHILKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQPRWDYWG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCSSHILKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQPRWDYWG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query185 2.2.26 [Sep-21-2011]
Q9SFU3 532 Purple acid phosphatase 1 yes no 0.956 0.332 0.620 2e-61
Q6TPH1 458 Purple acid phosphatase 2 no no 0.956 0.386 0.452 8e-41
O48840 545 Purple acid phosphatase 1 no no 0.972 0.330 0.459 1e-40
Q8S340 434 Purple acid phosphatase 2 no no 0.654 0.278 0.306 6e-10
Q9LXI7 427 Probable purple acid phos no no 0.389 0.168 0.392 6e-09
Q93WP4 481 Phosphoenolpyruvate phosp N/A no 0.551 0.212 0.327 5e-08
Q9LXI4 437 Purple acid phosphatase 2 no no 0.654 0.276 0.275 9e-08
Q949Y3 475 Bifunctional purple acid no no 0.508 0.197 0.293 7e-07
Q9LJU7 437 Purple acid phosphatase 1 no no 0.616 0.260 0.323 3e-06
Q38924 469 Fe(3+)-Zn(2+) purple acid no no 0.578 0.228 0.301 7e-06
>sp|Q9SFU3|PPA15_ARATH Purple acid phosphatase 15 OS=Arabidopsis thaliana GN=PAP15 PE=1 SV=1 Back     alignment and function desciption
 Score =  234 bits (598), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 140/187 (74%), Gaps = 10/187 (5%)

Query: 4   VWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKL 63
           +W++   GEFQIG  +K L+P S+ SVV++GTLR  L+  A  HSLV +QLYPF      
Sbjct: 78  IWVSWITGEFQIGKKVKPLDPTSINSVVQFGTLRHSLSHEAKGHSLVYSQLYPFDG---- 133

Query: 64  HLWNHTQCSSHI-----LKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIV 118
            L N+T    H      LKP T+YYY+CGDPS  AMS  ++FRTMP SSP+SYP RIA+V
Sbjct: 134 -LLNYTSGIIHHVRITGLKPSTIYYYRCGDPSRRAMSKIHHFRTMPVSSPSSYPGRIAVV 192

Query: 119 GDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQ 178
           GD+GLTYNTT T+SH+I N PDLILL+GDV+YANLYLTNGT  DCYSCSF  +PI+ETYQ
Sbjct: 193 GDLGLTYNTTDTISHLIHNSPDLILLIGDVSYANLYLTNGTSSDCYSCSFPETPIHETYQ 252

Query: 179 PRWDYWG 185
           PRWDYWG
Sbjct: 253 PRWDYWG 259




Acid phosphatase activity with p-nitrophenyl phosphate (pNPP), D-myoinositol 1-phosphate (Ins(1)P1), phytic acid and Myo-inositol hexakisphosphate. Low or no activity with Glc-6-P and ATP. Confers shoot growth stimulation, enhanced salt and osmotic stress tolerance, and ABA insensitivity. May modulate ascorbic acid (AsA) levels by controlling the input of myoinositol into this branch of AsA biosynthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 2
>sp|Q6TPH1|PPA23_ARATH Purple acid phosphatase 23 OS=Arabidopsis thaliana GN=PAP23 PE=1 SV=2 Back     alignment and function description
>sp|O48840|PPA13_ARATH Purple acid phosphatase 13 OS=Arabidopsis thaliana GN=PAP13 PE=2 SV=2 Back     alignment and function description
>sp|Q8S340|PPA22_ARATH Purple acid phosphatase 22 OS=Arabidopsis thaliana GN=PAP22 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXI7|PPA20_ARATH Probable purple acid phosphatase 20 OS=Arabidopsis thaliana GN=PAP20 PE=2 SV=1 Back     alignment and function description
>sp|Q93WP4|PEPP_ALLCE Phosphoenolpyruvate phosphatase OS=Allium cepa GN=ACPEPP PE=1 SV=1 Back     alignment and function description
>sp|Q9LXI4|PPA21_ARATH Purple acid phosphatase 21 OS=Arabidopsis thaliana GN=PAP21 PE=2 SV=1 Back     alignment and function description
>sp|Q949Y3|PPA26_ARATH Bifunctional purple acid phosphatase 26 OS=Arabidopsis thaliana GN=PAP26 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJU7|PPA18_ARATH Purple acid phosphatase 18 OS=Arabidopsis thaliana GN=PAP18 PE=2 SV=1 Back     alignment and function description
>sp|Q38924|PPA12_ARATH Fe(3+)-Zn(2+) purple acid phosphatase 12 OS=Arabidopsis thaliana GN=PAP12 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
224141249 542 predicted protein [Populus trichocarpa] 0.956 0.326 0.695 6e-66
145839433 551 purple acid phosphatase [Nicotiana tabac 0.972 0.326 0.657 4e-63
357462713 693 Purple acid phosphatase [Medicago trunca 0.956 0.255 0.657 2e-62
147798298 540 hypothetical protein VITISV_037278 [Viti 0.956 0.327 0.652 4e-62
225469592 540 PREDICTED: purple acid phosphatase 15 [V 0.956 0.327 0.652 5e-62
357462711 543 Purple acid phosphatase [Medicago trunca 0.956 0.325 0.647 6e-62
62177683 543 phytase [Medicago truncatula] 0.956 0.325 0.647 6e-62
356538043 489 PREDICTED: purple acid phosphatase 15-li 0.972 0.368 0.635 2e-61
118486309 555 unknown [Populus trichocarpa] 0.956 0.318 0.652 6e-61
281181750 543 phytase [Lupinus albus] 0.967 0.329 0.628 1e-60
>gi|224141249|ref|XP_002323987.1| predicted protein [Populus trichocarpa] gi|222866989|gb|EEF04120.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 130/187 (69%), Positives = 146/187 (78%), Gaps = 10/187 (5%)

Query: 4   VWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKL 63
           VWI+   G+FQIG+ IK LNPK+V SVVRYG LR  L  +AT +SLV NQLYPF     +
Sbjct: 84  VWISWITGDFQIGDRIKPLNPKTVASVVRYGRLRIPLIHKATGYSLVYNQLYPF-----V 138

Query: 64  HLWNHTQCSSHI-----LKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIV 118
            L N+T    H      LKP+TLY+YQCGDPSIPAMS  YYF+TMP S P SYPSRIAIV
Sbjct: 139 GLQNYTSGIIHHVRLTGLKPNTLYHYQCGDPSIPAMSSKYYFKTMPASGPKSYPSRIAIV 198

Query: 119 GDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQ 178
           GD+GLTYNTTSTV H+I N PDLILLVGDV YANLYLTNGTG DCYSCSF+ +PI+ETYQ
Sbjct: 199 GDLGLTYNTTSTVDHVIGNNPDLILLVGDVCYANLYLTNGTGADCYSCSFSQTPIHETYQ 258

Query: 179 PRWDYWG 185
           PRWDYWG
Sbjct: 259 PRWDYWG 265




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|145839433|gb|ABP96799.1| purple acid phosphatase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|357462713|ref|XP_003601638.1| Purple acid phosphatase [Medicago truncatula] gi|355490686|gb|AES71889.1| Purple acid phosphatase [Medicago truncatula] Back     alignment and taxonomy information
>gi|147798298|emb|CAN65638.1| hypothetical protein VITISV_037278 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225469592|ref|XP_002272478.1| PREDICTED: purple acid phosphatase 15 [Vitis vinifera] gi|296088799|emb|CBI38249.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357462711|ref|XP_003601637.1| Purple acid phosphatase [Medicago truncatula] gi|355490685|gb|AES71888.1| Purple acid phosphatase [Medicago truncatula] Back     alignment and taxonomy information
>gi|62177683|gb|AAX71115.1| phytase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356538043|ref|XP_003537514.1| PREDICTED: purple acid phosphatase 15-like [Glycine max] Back     alignment and taxonomy information
>gi|118486309|gb|ABK94996.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|281181750|dbj|BAI58054.1| phytase [Lupinus albus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
TAIR|locus:2098500 532 PAP15 "purple acid phosphatase 0.956 0.332 0.620 3.9e-60
TAIR|locus:2046407 545 PAP13 "purple acid phosphatase 0.972 0.330 0.469 1.6e-40
TAIR|locus:2083288 427 PAP20 [Arabidopsis thaliana (t 0.664 0.288 0.316 4e-12
TAIR|locus:2083238 434 PAP22 "purple acid phosphatase 0.605 0.258 0.359 4.1e-11
TAIR|locus:2083218 437 PAP21 "purple acid phosphatase 0.610 0.258 0.302 5.5e-11
TAIR|locus:2085770 437 PAP18 "purple acid phosphatase 0.616 0.260 0.330 1.3e-08
TAIR|locus:2184657 475 PAP26 "AT5G34850" [Arabidopsis 0.735 0.286 0.283 1.5e-08
TAIR|locus:2005533 469 PAP12 "AT2G27190" [Arabidopsis 0.637 0.251 0.315 1.9e-08
TAIR|locus:2042689 468 PAP10 "AT2G16430" [Arabidopsis 0.567 0.224 0.299 1.5e-05
UNIPROTKB|Q09131 464 PAP "Purple acid phosphatase" 0.637 0.254 0.285 7e-05
TAIR|locus:2098500 PAP15 "purple acid phosphatase 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 616 (221.9 bits), Expect = 3.9e-60, P = 3.9e-60
 Identities = 116/187 (62%), Positives = 141/187 (75%)

Query:     4 VWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKL 63
             +W++   GEFQIG  +K L+P S+ SVV++GTLR  L+  A  HSLV +QLYPF      
Sbjct:    78 IWVSWITGEFQIGKKVKPLDPTSINSVVQFGTLRHSLSHEAKGHSLVYSQLYPFDG---- 133

Query:    64 HLWNHTQ-CSSHI----LKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIV 118
              L N+T     H+    LKP T+YYY+CGDPS  AMS  ++FRTMP SSP+SYP RIA+V
Sbjct:   134 -LLNYTSGIIHHVRITGLKPSTIYYYRCGDPSRRAMSKIHHFRTMPVSSPSSYPGRIAVV 192

Query:   119 GDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQ 178
             GD+GLTYNTT T+SH+I N PDLILL+GDV+YANLYLTNGT  DCYSCSF  +PI+ETYQ
Sbjct:   193 GDLGLTYNTTDTISHLIHNSPDLILLIGDVSYANLYLTNGTSSDCYSCSFPETPIHETYQ 252

Query:   179 PRWDYWG 185
             PRWDYWG
Sbjct:   253 PRWDYWG 259




GO:0003993 "acid phosphatase activity" evidence=IEA;ISS;IDA
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0016787 "hydrolase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0009845 "seed germination" evidence=IMP
GO:0009846 "pollen germination" evidence=IMP
TAIR|locus:2046407 PAP13 "purple acid phosphatase 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083288 PAP20 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083238 PAP22 "purple acid phosphatase 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083218 PAP21 "purple acid phosphatase 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085770 PAP18 "purple acid phosphatase 18" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184657 PAP26 "AT5G34850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005533 PAP12 "AT2G27190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042689 PAP10 "AT2G16430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q09131 PAP "Purple acid phosphatase" [Glycine max (taxid:3847)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!
3rd Layer3.1.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
PLN02533 427 PLN02533, PLN02533, probable purple acid phosphata 7e-13
cd00839 294 cd00839, MPP_PAPs, purple acid phosphatases of the 2e-06
>gnl|CDD|215292 PLN02533, PLN02533, probable purple acid phosphatase Back     alignment and domain information
 Score = 65.5 bits (159), Expect = 7e-13
 Identities = 32/79 (40%), Positives = 49/79 (62%), Gaps = 7/79 (8%)

Query: 76  LKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMI 135
           LKP+T+YYY+CG PS    +  + FRT     P+ +P + A+ GD+G +  T ST+ H+ 
Sbjct: 110 LKPNTVYYYKCGGPS---STQEFSFRT----PPSKFPIKFAVSGDLGTSEWTKSTLEHVS 162

Query: 136 SNRPDLILLVGDVTYANLY 154
               D+ +L GD++YAN Y
Sbjct: 163 KWDYDVFILPGDLSYANFY 181


Length = 427

>gnl|CDD|163615 cd00839, MPP_PAPs, purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 185
PLN02533 427 probable purple acid phosphatase 99.96
KOG1378 452 consensus Purple acid phosphatase [Carbohydrate tr 99.95
PF09423 453 PhoD: PhoD-like phosphatase; InterPro: IPR018946 T 99.4
COG3540 522 PhoD Phosphodiesterase/alkaline phosphatase D [Ino 99.18
cd00839 294 MPP_PAPs purple acid phosphatases of the metalloph 98.34
cd07378 277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 97.41
PF00149 200 Metallophos: Calcineurin-like phosphoesterase; Int 96.79
KOG2679 336 consensus Purple (tartrate-resistant) acid phospha 95.5
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 95.39
cd07396 267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 94.93
cd07383 199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 94.67
cd07402 240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 94.56
PTZ00422 394 glideosome-associated protein 50; Provisional 94.52
cd07389 228 MPP_PhoD Bacillus subtilis PhoD and related protei 94.3
cd07399 214 MPP_YvnB Bacillus subtilis YvnB and related protei 94.26
cd07385 223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 94.23
cd07395 262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 94.15
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 93.31
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 92.61
cd07397 238 MPP_DevT Myxococcus xanthus DevT and related prote 91.96
PRK09453 182 phosphodiesterase; Provisional 91.67
cd07392 188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 91.52
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 91.41
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 91.27
PRK11148 275 cyclic 3',5'-adenosine monophosphate phosphodieste 91.24
COG0622172 Predicted phosphoesterase [General function predic 91.0
cd07394 178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 90.76
cd00840 223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 90.28
PRK11340 271 phosphodiesterase YaeI; Provisional 90.07
cd07388 224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 89.69
cd00838131 MPP_superfamily metallophosphatase superfamily, me 89.61
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 88.38
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 87.69
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 87.21
TIGR03729 239 acc_ester putative phosphoesterase. Members of thi 86.93
PRK05340 241 UDP-2,3-diacylglucosamine hydrolase; Provisional 86.21
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 85.89
cd0006393 FN3 Fibronectin type 3 domain; One of three types 84.73
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 84.2
KOG1432 379 consensus Predicted DNA repair exonuclease SIA1 [G 84.07
PHA02546 340 47 endonuclease subunit; Provisional 83.77
COG1409 301 Icc Predicted phosphohydrolases [General function 82.98
smart0006083 FN3 Fibronectin type 3 domain. One of three types 82.32
TIGR00619 253 sbcd exonuclease SbcD. This family is based on the 81.79
COG2129 226 Predicted phosphoesterases, related to the Icc pro 80.72
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
Probab=99.96  E-value=3.6e-28  Score=217.41  Aligned_cols=139  Identities=29%  Similarity=0.473  Sum_probs=112.2

Q ss_pred             CceEEEEEEcCCCccccccccCCCCCCccEEEEeccCCCCCeEEEEEEEeeccccCccCCCCCCccceEEee-eCCCCCC
Q 047688            1 MYIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCS-SHILKPD   79 (185)
Q Consensus         1 ~~~m~VsW~T~~~~~~~~~~~~~p~~~~s~V~yG~~~~~l~~~a~g~~~~y~~~~~~~~~~~~G~~~y~h~v-l~gL~P~   79 (185)
                      +++|+|+|.|...             ..+.|+||++++.|..++.|++++|....       .....|+|.| |++|+|+
T Consensus        54 ~~~m~V~W~T~~~-------------~~~~V~yG~~~~~l~~~a~g~~~~~~~~~-------~~~~g~iH~v~l~~L~p~  113 (427)
T PLN02533         54 PDKMRISWITQDS-------------IPPSVVYGTVSGKYEGSANGTSSSYHYLL-------IYRSGQINDVVIGPLKPN  113 (427)
T ss_pred             CCeEEEEEECCCC-------------CCCEEEEecCCCCCcceEEEEEEEEeccc-------cccCCeEEEEEeCCCCCC
Confidence            3689999999982             46899999999999999999988887320       0123466665 7999999


Q ss_pred             CEEEEEcccCCCCCCCceeEEecCCCCCCCCCCeEEEEEeecCCCCChHHHHHHHHhCCCcEEEEcCceeccCCCCCCCC
Q 047688           80 TLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGT  159 (185)
Q Consensus        80 T~Y~Yrvg~~~~~~~S~~~~F~T~p~~~~~~~~~~f~~~GD~G~~~~~~~t~~~l~~~~~dfilh~GDlaYAd~~~~~g~  159 (185)
                      |+|+||||..   .+|++|+|+|+|..    .+++|+++||||.......+++++.+.++|||||+|||+|++.+   ..
T Consensus       114 T~Y~Yrvg~~---~~s~~~~F~T~p~~----~~~~f~v~GDlG~~~~~~~tl~~i~~~~pD~vl~~GDl~y~~~~---~~  183 (427)
T PLN02533        114 TVYYYKCGGP---SSTQEFSFRTPPSK----FPIKFAVSGDLGTSEWTKSTLEHVSKWDYDVFILPGDLSYANFY---QP  183 (427)
T ss_pred             CEEEEEECCC---CCccceEEECCCCC----CCeEEEEEEeCCCCcccHHHHHHHHhcCCCEEEEcCccccccch---HH
Confidence            9999999965   46999999998864    48999999999986555567889988999999999999998654   34


Q ss_pred             cccccccccC
Q 047688          160 GFDCYSCSFA  169 (185)
Q Consensus       160 ~gd~f~~~~~  169 (185)
                      .+|.|++.++
T Consensus       184 ~wd~f~~~i~  193 (427)
T PLN02533        184 LWDTFGRLVQ  193 (427)
T ss_pred             HHHHHHHHhh
Confidence            5677777654



>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B Back     alignment and domain information
>COG3540 PhoD Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>cd07389 MPP_PhoD Bacillus subtilis PhoD and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
1xzw_A 426 Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPL 3e-05
4dsy_A 426 Crystal Structure Of Red Kidney Bean Purple Acid Ph 3e-04
2qfp_A 424 Crystal Structure Of Red Kidney Bean Purple Acid Ph 3e-04
1kbp_A 432 Kidney Bean Purple Acid Phosphatase Length = 432 3e-04
>pdb|1XZW|A Chain A, Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPLEX Length = 426 Back     alignment and structure

Iteration: 1

Score = 44.7 bits (104), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 25/118 (21%) Query: 70 QCSSHILKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTS 129 C+ L+ DT YYY+ G ++F T P P P ++GD+G T+++ + Sbjct: 88 HCTIKDLEYDTKYYYRLG---FGDAKRQFWFVTPPKPGP-DVPYVFGLIGDIGQTHDSNT 143 Query: 130 TVSHMISN--RPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQPRWDYWG 185 T++H N + +L +GD++Y+N + + RWD WG Sbjct: 144 TLTHYEQNSAKGQAVLFMGDLSYSNRWPNHDNN-------------------RWDTWG 182
>pdb|4DSY|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase In Complex With Maybridge Fragment Cc24201 Length = 426 Back     alignment and structure
>pdb|2QFP|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase In Complex With Fluoride Length = 424 Back     alignment and structure
>pdb|1KBP|A Chain A, Kidney Bean Purple Acid Phosphatase Length = 432 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 8e-17
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 6e-14
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Length = 426 Back     alignment and structure
 Score = 76.3 bits (187), Expect = 8e-17
 Identities = 37/167 (22%), Positives = 69/167 (41%), Gaps = 32/167 (19%)

Query: 21  SLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCSSHILKPDT 80
           +   K+  + V Y +  S+  +RA    +       +   +    + H  C+   L+ DT
Sbjct: 46  TPYDKAGANKVFYWSENSKSQKRAMGTVVT------YKYYNYTSAFIHH-CTIKDLEYDT 98

Query: 81  LYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISN--R 138
            YYY+ G          ++F T P   P   P    ++GD+G T+++ +T++H   N  +
Sbjct: 99  KYYYRLGFGD---AKRQFWFVTPPKPGP-DVPYVFGLIGDIGQTHDSNTTLTHYEQNSAK 154

Query: 139 PDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQPRWDYWG 185
              +L +GD++Y+N +  +                      RWD WG
Sbjct: 155 GQAVLFMGDLSYSNRWPNH-------------------DNNRWDTWG 182


>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Length = 424 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 99.91
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 99.9
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 99.7
1ute_A 313 Protein (II purple acid phosphatase); tartrate res 97.44
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 97.07
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 97.02
1x4x_A106 Fibronectin type-III domain containing protein 3A; 97.0
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 96.98
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 96.89
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 96.75
2crz_A110 Fibronectin type-III domain containing protein 3A; 96.73
1x5x_A109 Fibronectin type-III domain containing protein 3A; 96.68
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 96.67
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 96.67
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 96.66
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 96.63
3tgh_A 342 Glideosome-associated protein 50; phosphatase fold 96.62
3ib7_A 330 ICC protein; metallophosphoesterase, alpha-beta fo 96.55
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 96.52
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 96.32
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 96.32
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 96.3
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 96.26
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 96.2
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 96.16
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 96.02
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 96.0
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 95.97
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 95.89
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 95.87
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 95.76
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 95.74
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 95.72
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 95.72
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 95.7
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 95.7
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 95.67
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 95.67
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 95.62
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 95.47
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 95.44
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 95.38
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 95.37
1x3d_A118 Fibronectin type-III domain containing protein 3A; 95.34
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 95.31
2nxf_A 322 Putative dimetal phosphatase; dinuclear metal cent 95.26
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 95.26
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 95.18
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 95.14
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 95.12
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 95.05
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 95.0
2crm_A120 Fibronectin type-III domain containing protein 3A; 94.94
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 94.92
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 94.88
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 94.87
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 94.86
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 94.86
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 94.83
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 94.73
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 94.71
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 94.67
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 94.65
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 94.64
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 94.62
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 94.61
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 94.59
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 94.5
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 94.48
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 94.28
2yvt_A 260 Hypothetical protein AQ_1956; structural genomics, 94.23
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 94.22
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 94.2
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 94.2
1uf3_A 228 Hypothetical protein TT1561; metallo-dependent pho 94.1
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 93.99
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 93.99
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 93.98
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 93.92
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 93.84
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 93.68
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 93.64
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 93.45
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 93.44
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 93.36
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 93.32
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 93.22
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 93.21
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 93.2
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 93.17
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 93.15
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 93.15
3d03_A 274 Phosphohydrolase; glycerophosphodiesterase, metall 93.11
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 93.09
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 93.04
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 93.0
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 92.89
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 92.85
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 92.72
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 92.64
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 92.63
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 92.52
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 92.46
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 92.1
3qfm_A 270 SAPH, putative uncharacterized protein; sandwich f 91.94
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 91.85
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 91.77
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 91.58
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 91.46
3ck2_A176 Conserved uncharacterized protein (predicted phosp 91.4
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 91.37
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 91.22
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 91.16
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 91.13
2a22_A 215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 91.01
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 90.72
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 90.18
1eer_B227 Epobp, erythropoietin receptor; signal transductio 90.03
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 89.92
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 89.91
1ii7_A 333 MRE11 nuclease; RAD50, DNA double-strand break rep 89.82
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 89.8
1z2w_A 192 Vacuolar protein sorting 29; VPS29, retromer, phos 89.69
1nnw_A 252 Hypothetical protein; structural genomics, PSI, pr 89.6
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 89.43
1su1_A 208 Hypothetical protein YFCE; structural genomics, ph 89.32
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 89.24
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 89.21
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 88.28
3k2m_C101 Monobody HA4; engineered binding protein, antibody 88.23
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 88.18
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 88.03
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 87.97
1xm7_A 195 Hypothetical protein AQ_1665; structural genomics, 87.92
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 87.64
3t04_D103 Monobody 7C12; engineered binding protein, antibod 87.43
2q8u_A 336 Exonuclease, putative; structural genomics, joint 87.21
3rqz_A 246 Metallophosphoesterase; PSI-biology, midwest cente 86.89
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 86.83
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 86.43
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 86.43
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 86.38
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 85.9
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 85.81
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 85.6
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 85.58
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 85.52
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 85.04
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 84.68
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 84.66
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 84.04
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 83.64
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 83.51
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 83.2
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 82.56
1g5b_A 221 Serine/threonine protein phosphatase; bacteriophag 82.29
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 81.94
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 80.67
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 80.4
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
Probab=99.91  E-value=1e-23  Score=185.29  Aligned_cols=129  Identities=24%  Similarity=0.356  Sum_probs=104.2

Q ss_pred             ceEEEEEEcCCCccccccccCCCCCCccEEEEeccCCCCCeEEEEEEEeeccccCccCCCCCCccceEEee-eCCCCCCC
Q 047688            2 YIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCS-SHILKPDT   80 (185)
Q Consensus         2 ~~m~VsW~T~~~~~~~~~~~~~p~~~~s~V~yG~~~~~l~~~a~g~~~~y~~~~~~~~~~~~G~~~y~h~v-l~gL~P~T   80 (185)
                      ++|+|+|+|...            ...+.|+||++++.+..++.|++++|...        .....|+|.| ++||+|+|
T Consensus        32 ~~~~v~W~t~~~------------~~~~~V~~~~~~~~~~~~~~g~~~~~~~~--------~~~~~~~~~v~l~gL~p~t   91 (424)
T 2qfp_A           32 RAMIISWVTMDE------------PGSSAVRYWSEKNGRKRIAKGKMSTYRFF--------NYSSGFIHHTTIRKLKYNT   91 (424)
T ss_dssp             SCEEEEEEESSS------------CCCCCEEEEESSSCCCEEECCEEECCBCS--------SCBCCEEEEEEECSCCTTC
T ss_pred             CeEEEEEECCCC------------CCCCEEEEEeCCCCCceEEEEEEEEEEec--------CCCCCEEEEEEECCCCCCC
Confidence            589999999772            35789999999998988999988877642        0123466655 79999999


Q ss_pred             EEEEEcccCCCCCCCceeEEecCCCCCCCCCCeEEEEEeecCCCCChHHHHHHHHhC--CCcEEEEcCceeccCCC
Q 047688           81 LYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISN--RPDLILLVGDVTYANLY  154 (185)
Q Consensus        81 ~Y~Yrvg~~~~~~~S~~~~F~T~p~~~~~~~~~~f~~~GD~G~~~~~~~t~~~l~~~--~~dfilh~GDlaYAd~~  154 (185)
                      +|+|||+.+   .+|++++|+|+|.+++ ..+++|+++||+|...+...+++++.+.  ++|||||+||++|+++.
T Consensus        92 ~Y~Yrv~~~---~~s~~~~f~T~p~~~~-~~~~~f~~igD~~~~~~~~~~l~~~~~~~~~~D~vl~~GDl~y~~~~  163 (424)
T 2qfp_A           92 KYYYEVGLR---NTTRRFSFITPPQTGL-DVPYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRY  163 (424)
T ss_dssp             EEEEEECCS---SSCEEEEEECCCCCCT-TCCEEEEEECSCTTBHHHHHHHHHHHTCSSCCCEEEECSCCSCGGGS
T ss_pred             EEEEEECCC---CccceEEEECCCCCCC-CCCeEEEEEEeCCCCCChHHHHHHHHhCCCCCCEEEEcCcccccccc
Confidence            999999986   5899999999998753 3589999999999754444567777765  89999999999998654



>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 185
d2qfra2 312 d.159.1.1 (A:121-432) Plant purple acid phosphatas 1e-07
d2qfra1112 b.1.12.1 (A:9-120) Purple acid phosphatase, N-term 1e-06
d1xzwa1119 b.1.12.1 (A:1-119) Purple acid phosphatase, N-term 1e-05
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 312 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Plant purple acid phosphatase, catalytic domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 48.0 bits (113), Expect = 1e-07
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 21/76 (27%)

Query: 112 PSRIAIVGDVGLTYNTTSTVSHMI--SNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFA 169
           P    ++GD+G ++++ +T+SH      +   +L VGD++YA+ Y  +            
Sbjct: 7   PYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNH------------ 54

Query: 170 NSPIYETYQPRWDYWG 185
                     RWD WG
Sbjct: 55  -------DNVRWDTWG 63


>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 112 Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Length = 119 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 99.82
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 99.81
d2qfra2 312 Plant purple acid phosphatase, catalytic domain {K 98.75
d1utea_ 302 Mammalian purple acid phosphatase {Pig (Sus scrofa 97.95
d1x4xa193 Fibronectin type-III domain containing protein 3a, 97.66
d1x5xa196 Fibronectin type-III domain containing protein 3a, 97.55
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 97.55
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 97.33
d2crza197 Fibronectin type-III domain containing protein 3a, 97.28
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 97.21
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 97.21
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 97.08
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 96.94
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.93
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 96.89
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 96.83
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 96.81
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 96.75
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 96.7
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 96.67
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 96.66
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 96.65
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 96.63
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 96.62
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 96.55
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 96.51
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 96.48
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 96.48
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 96.47
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 96.45
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 96.43
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 96.43
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 96.42
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 96.42
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 96.42
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 96.4
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 96.4
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 96.4
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 96.39
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 96.33
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 96.29
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 96.22
d1va9a1109 Down syndrome cell adhesion molecule-like protein 96.21
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 96.19
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 96.11
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 96.06
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 96.05
d1x3da1105 Fibronectin type-III domain containing protein 3a, 96.05
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 96.04
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 96.01
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.0
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 95.86
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 95.82
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 95.78
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 95.78
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 95.75
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 95.74
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 95.73
d2yvta1 257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 95.61
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 95.59
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 95.51
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 95.5
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 95.49
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 95.41
d2nxfa1 320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 95.35
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 95.24
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 95.23
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 95.17
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 95.12
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 94.93
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 94.86
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 94.75
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 94.53
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 94.53
d2crma1107 Fibronectin type-III domain containing protein 3a, 94.45
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 94.34
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 94.33
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 94.07
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 93.43
d1su1a_ 184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 93.43
d2hy1a1 256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 93.13
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 92.8
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 92.59
d1uf3a_ 228 Hypothetical protein TT1561 {Thermus thermophilus 92.55
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 92.52
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 92.21
d1z2wa1 182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 91.91
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 91.79
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 91.68
d1ii7a_ 333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.18
d2a22a1 193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 89.93
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 89.71
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 89.66
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 89.08
d1nnwa_ 251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 88.28
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 86.62
d3d03a1 271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 85.92
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 84.8
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 82.43
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Purple acid phosphatase, N-terminal domain
family: Purple acid phosphatase, N-terminal domain
domain: Purple acid phosphatase, N-terminal domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.82  E-value=3.6e-20  Score=135.05  Aligned_cols=80  Identities=21%  Similarity=0.184  Sum_probs=65.7

Q ss_pred             ceEEEEEEcCCCccccccccCCCCCCccEEEEeccCCCCCeEEEEEEEeeccccCccCCCCCCccceEEee-eCCCCCCC
Q 047688            2 YIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCS-SHILKPDT   80 (185)
Q Consensus         2 ~~m~VsW~T~~~~~~~~~~~~~p~~~~s~V~yG~~~~~l~~~a~g~~~~y~~~~~~~~~~~~G~~~y~h~v-l~gL~P~T   80 (185)
                      ++|+|+|+|...            ...+.|+||++++.+..++.|...+|...       . ....|+|.| |+||+|+|
T Consensus        32 tsm~VsW~T~~~------------~~~~~V~yg~~~~~~~~~a~~~~~~~~~~-------~-~~~~~~h~v~Lt~L~P~T   91 (112)
T d2qfra1          32 RAMIISWVTMDE------------PGSSAVRYWSEKNGRKRIAKGKMSTYRFF-------N-YSSGFIHHTTIRKLKYNT   91 (112)
T ss_dssp             SCEEEEEEESSS------------CCCCEEEEEESSSCCCEEEECEEECCBCS-------S-CBCCEEEEEEECSCCTTC
T ss_pred             CEEEEEEECCCC------------CCCcEEEEEECCCCCCcEEEEEEEEEEec-------c-cCCcEEEEEEECCCCCCC
Confidence            589999999761            46899999999999999999998877632       1 122355555 79999999


Q ss_pred             EEEEEcccCCCCCCCceeEEecCC
Q 047688           81 LYYYQCGDPSIPAMSGTYYFRTMP  104 (185)
Q Consensus        81 ~Y~Yrvg~~~~~~~S~~~~F~T~p  104 (185)
                      +|+||||++   +||++|+|+|+|
T Consensus        92 ~Y~YrVG~~---~~S~~~~F~T~P  112 (112)
T d2qfra1          92 KYYYEVGLR---NTTRRFSFITPP  112 (112)
T ss_dssp             EEEEEECCS---SSCEEEEEECCC
T ss_pred             EEEEEECCC---CceeeEEEEcCC
Confidence            999999975   699999999987



>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure