Citrus Sinensis ID: 047688
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 185 | ||||||
| 224141249 | 542 | predicted protein [Populus trichocarpa] | 0.956 | 0.326 | 0.695 | 6e-66 | |
| 145839433 | 551 | purple acid phosphatase [Nicotiana tabac | 0.972 | 0.326 | 0.657 | 4e-63 | |
| 357462713 | 693 | Purple acid phosphatase [Medicago trunca | 0.956 | 0.255 | 0.657 | 2e-62 | |
| 147798298 | 540 | hypothetical protein VITISV_037278 [Viti | 0.956 | 0.327 | 0.652 | 4e-62 | |
| 225469592 | 540 | PREDICTED: purple acid phosphatase 15 [V | 0.956 | 0.327 | 0.652 | 5e-62 | |
| 357462711 | 543 | Purple acid phosphatase [Medicago trunca | 0.956 | 0.325 | 0.647 | 6e-62 | |
| 62177683 | 543 | phytase [Medicago truncatula] | 0.956 | 0.325 | 0.647 | 6e-62 | |
| 356538043 | 489 | PREDICTED: purple acid phosphatase 15-li | 0.972 | 0.368 | 0.635 | 2e-61 | |
| 118486309 | 555 | unknown [Populus trichocarpa] | 0.956 | 0.318 | 0.652 | 6e-61 | |
| 281181750 | 543 | phytase [Lupinus albus] | 0.967 | 0.329 | 0.628 | 1e-60 |
| >gi|224141249|ref|XP_002323987.1| predicted protein [Populus trichocarpa] gi|222866989|gb|EEF04120.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 255 bits (651), Expect = 6e-66, Method: Compositional matrix adjust.
Identities = 130/187 (69%), Positives = 146/187 (78%), Gaps = 10/187 (5%)
Query: 4 VWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKL 63
VWI+ G+FQIG+ IK LNPK+V SVVRYG LR L +AT +SLV NQLYPF +
Sbjct: 84 VWISWITGDFQIGDRIKPLNPKTVASVVRYGRLRIPLIHKATGYSLVYNQLYPF-----V 138
Query: 64 HLWNHTQCSSHI-----LKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIV 118
L N+T H LKP+TLY+YQCGDPSIPAMS YYF+TMP S P SYPSRIAIV
Sbjct: 139 GLQNYTSGIIHHVRLTGLKPNTLYHYQCGDPSIPAMSSKYYFKTMPASGPKSYPSRIAIV 198
Query: 119 GDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQ 178
GD+GLTYNTTSTV H+I N PDLILLVGDV YANLYLTNGTG DCYSCSF+ +PI+ETYQ
Sbjct: 199 GDLGLTYNTTSTVDHVIGNNPDLILLVGDVCYANLYLTNGTGADCYSCSFSQTPIHETYQ 258
Query: 179 PRWDYWG 185
PRWDYWG
Sbjct: 259 PRWDYWG 265
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|145839433|gb|ABP96799.1| purple acid phosphatase [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|357462713|ref|XP_003601638.1| Purple acid phosphatase [Medicago truncatula] gi|355490686|gb|AES71889.1| Purple acid phosphatase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147798298|emb|CAN65638.1| hypothetical protein VITISV_037278 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225469592|ref|XP_002272478.1| PREDICTED: purple acid phosphatase 15 [Vitis vinifera] gi|296088799|emb|CBI38249.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357462711|ref|XP_003601637.1| Purple acid phosphatase [Medicago truncatula] gi|355490685|gb|AES71888.1| Purple acid phosphatase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|62177683|gb|AAX71115.1| phytase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356538043|ref|XP_003537514.1| PREDICTED: purple acid phosphatase 15-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|118486309|gb|ABK94996.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|281181750|dbj|BAI58054.1| phytase [Lupinus albus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 185 | ||||||
| TAIR|locus:2098500 | 532 | PAP15 "purple acid phosphatase | 0.956 | 0.332 | 0.620 | 3.9e-60 | |
| TAIR|locus:2046407 | 545 | PAP13 "purple acid phosphatase | 0.972 | 0.330 | 0.469 | 1.6e-40 | |
| TAIR|locus:2083288 | 427 | PAP20 [Arabidopsis thaliana (t | 0.664 | 0.288 | 0.316 | 4e-12 | |
| TAIR|locus:2083238 | 434 | PAP22 "purple acid phosphatase | 0.605 | 0.258 | 0.359 | 4.1e-11 | |
| TAIR|locus:2083218 | 437 | PAP21 "purple acid phosphatase | 0.610 | 0.258 | 0.302 | 5.5e-11 | |
| TAIR|locus:2085770 | 437 | PAP18 "purple acid phosphatase | 0.616 | 0.260 | 0.330 | 1.3e-08 | |
| TAIR|locus:2184657 | 475 | PAP26 "AT5G34850" [Arabidopsis | 0.735 | 0.286 | 0.283 | 1.5e-08 | |
| TAIR|locus:2005533 | 469 | PAP12 "AT2G27190" [Arabidopsis | 0.637 | 0.251 | 0.315 | 1.9e-08 | |
| TAIR|locus:2042689 | 468 | PAP10 "AT2G16430" [Arabidopsis | 0.567 | 0.224 | 0.299 | 1.5e-05 | |
| UNIPROTKB|Q09131 | 464 | PAP "Purple acid phosphatase" | 0.637 | 0.254 | 0.285 | 7e-05 |
| TAIR|locus:2098500 PAP15 "purple acid phosphatase 15" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 616 (221.9 bits), Expect = 3.9e-60, P = 3.9e-60
Identities = 116/187 (62%), Positives = 141/187 (75%)
Query: 4 VWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKL 63
+W++ GEFQIG +K L+P S+ SVV++GTLR L+ A HSLV +QLYPF
Sbjct: 78 IWVSWITGEFQIGKKVKPLDPTSINSVVQFGTLRHSLSHEAKGHSLVYSQLYPFDG---- 133
Query: 64 HLWNHTQ-CSSHI----LKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIV 118
L N+T H+ LKP T+YYY+CGDPS AMS ++FRTMP SSP+SYP RIA+V
Sbjct: 134 -LLNYTSGIIHHVRITGLKPSTIYYYRCGDPSRRAMSKIHHFRTMPVSSPSSYPGRIAVV 192
Query: 119 GDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQ 178
GD+GLTYNTT T+SH+I N PDLILL+GDV+YANLYLTNGT DCYSCSF +PI+ETYQ
Sbjct: 193 GDLGLTYNTTDTISHLIHNSPDLILLIGDVSYANLYLTNGTSSDCYSCSFPETPIHETYQ 252
Query: 179 PRWDYWG 185
PRWDYWG
Sbjct: 253 PRWDYWG 259
|
|
| TAIR|locus:2046407 PAP13 "purple acid phosphatase 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083288 PAP20 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083238 PAP22 "purple acid phosphatase 22" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083218 PAP21 "purple acid phosphatase 21" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085770 PAP18 "purple acid phosphatase 18" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2184657 PAP26 "AT5G34850" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2005533 PAP12 "AT2G27190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042689 PAP10 "AT2G16430" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q09131 PAP "Purple acid phosphatase" [Glycine max (taxid:3847)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 185 | |||
| PLN02533 | 427 | PLN02533, PLN02533, probable purple acid phosphata | 7e-13 | |
| cd00839 | 294 | cd00839, MPP_PAPs, purple acid phosphatases of the | 2e-06 |
| >gnl|CDD|215292 PLN02533, PLN02533, probable purple acid phosphatase | Back alignment and domain information |
|---|
Score = 65.5 bits (159), Expect = 7e-13
Identities = 32/79 (40%), Positives = 49/79 (62%), Gaps = 7/79 (8%)
Query: 76 LKPDTLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMI 135
LKP+T+YYY+CG PS + + FRT P+ +P + A+ GD+G + T ST+ H+
Sbjct: 110 LKPNTVYYYKCGGPS---STQEFSFRT----PPSKFPIKFAVSGDLGTSEWTKSTLEHVS 162
Query: 136 SNRPDLILLVGDVTYANLY 154
D+ +L GD++YAN Y
Sbjct: 163 KWDYDVFILPGDLSYANFY 181
|
Length = 427 |
| >gnl|CDD|163615 cd00839, MPP_PAPs, purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| PLN02533 | 427 | probable purple acid phosphatase | 99.96 | |
| KOG1378 | 452 | consensus Purple acid phosphatase [Carbohydrate tr | 99.95 | |
| PF09423 | 453 | PhoD: PhoD-like phosphatase; InterPro: IPR018946 T | 99.4 | |
| COG3540 | 522 | PhoD Phosphodiesterase/alkaline phosphatase D [Ino | 99.18 | |
| cd00839 | 294 | MPP_PAPs purple acid phosphatases of the metalloph | 98.34 | |
| cd07378 | 277 | MPP_ACP5 Homo sapiens acid phosphatase 5 and relat | 97.41 | |
| PF00149 | 200 | Metallophos: Calcineurin-like phosphoesterase; Int | 96.79 | |
| KOG2679 | 336 | consensus Purple (tartrate-resistant) acid phospha | 95.5 | |
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 95.39 | |
| cd07396 | 267 | MPP_Nbla03831 Homo sapiens Nbla03831 and related p | 94.93 | |
| cd07383 | 199 | MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase | 94.67 | |
| cd07402 | 240 | MPP_GpdQ Enterobacter aerogenes GpdQ and related p | 94.56 | |
| PTZ00422 | 394 | glideosome-associated protein 50; Provisional | 94.52 | |
| cd07389 | 228 | MPP_PhoD Bacillus subtilis PhoD and related protei | 94.3 | |
| cd07399 | 214 | MPP_YvnB Bacillus subtilis YvnB and related protei | 94.26 | |
| cd07385 | 223 | MPP_YkuE_C Bacillus subtilis YkuE and related prot | 94.23 | |
| cd07395 | 262 | MPP_CSTP1 Homo sapiens CSTP1 and related proteins, | 94.15 | |
| PF12850 | 156 | Metallophos_2: Calcineurin-like phosphoesterase su | 93.31 | |
| TIGR00040 | 158 | yfcE phosphoesterase, MJ0936 family. Members of th | 92.61 | |
| cd07397 | 238 | MPP_DevT Myxococcus xanthus DevT and related prote | 91.96 | |
| PRK09453 | 182 | phosphodiesterase; Provisional | 91.67 | |
| cd07392 | 188 | MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel | 91.52 | |
| cd00841 | 155 | MPP_YfcE Escherichia coli YfcE and related protein | 91.41 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 91.27 | |
| PRK11148 | 275 | cyclic 3',5'-adenosine monophosphate phosphodieste | 91.24 | |
| COG0622 | 172 | Predicted phosphoesterase [General function predic | 91.0 | |
| cd07394 | 178 | MPP_Vps29 Homo sapiens Vps29 and related proteins, | 90.76 | |
| cd00840 | 223 | MPP_Mre11_N Mre11 nuclease, N-terminal metallophos | 90.28 | |
| PRK11340 | 271 | phosphodiesterase YaeI; Provisional | 90.07 | |
| cd07388 | 224 | MPP_Tt1561 Thermus thermophilus Tt1561 and related | 89.69 | |
| cd00838 | 131 | MPP_superfamily metallophosphatase superfamily, me | 89.61 | |
| cd07379 | 135 | MPP_239FB Homo sapiens 239FB and related proteins, | 88.38 | |
| cd07400 | 144 | MPP_YydB Bacillus subtilis YydB and related protei | 87.69 | |
| cd07404 | 166 | MPP_MS158 Microscilla MS158 and related proteins, | 87.21 | |
| TIGR03729 | 239 | acc_ester putative phosphoesterase. Members of thi | 86.93 | |
| PRK05340 | 241 | UDP-2,3-diacylglucosamine hydrolase; Provisional | 86.21 | |
| COG0420 | 390 | SbcD DNA repair exonuclease [DNA replication, reco | 85.89 | |
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 84.73 | |
| TIGR00583 | 405 | mre11 DNA repair protein (mre11). All proteins in | 84.2 | |
| KOG1432 | 379 | consensus Predicted DNA repair exonuclease SIA1 [G | 84.07 | |
| PHA02546 | 340 | 47 endonuclease subunit; Provisional | 83.77 | |
| COG1409 | 301 | Icc Predicted phosphohydrolases [General function | 82.98 | |
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 82.32 | |
| TIGR00619 | 253 | sbcd exonuclease SbcD. This family is based on the | 81.79 | |
| COG2129 | 226 | Predicted phosphoesterases, related to the Icc pro | 80.72 |
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
Probab=99.96 E-value=3.6e-28 Score=217.41 Aligned_cols=139 Identities=29% Similarity=0.473 Sum_probs=112.2
Q ss_pred CceEEEEEEcCCCccccccccCCCCCCccEEEEeccCCCCCeEEEEEEEeeccccCccCCCCCCccceEEee-eCCCCCC
Q 047688 1 MYIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCS-SHILKPD 79 (185)
Q Consensus 1 ~~~m~VsW~T~~~~~~~~~~~~~p~~~~s~V~yG~~~~~l~~~a~g~~~~y~~~~~~~~~~~~G~~~y~h~v-l~gL~P~ 79 (185)
+++|+|+|.|... ..+.|+||++++.|..++.|++++|.... .....|+|.| |++|+|+
T Consensus 54 ~~~m~V~W~T~~~-------------~~~~V~yG~~~~~l~~~a~g~~~~~~~~~-------~~~~g~iH~v~l~~L~p~ 113 (427)
T PLN02533 54 PDKMRISWITQDS-------------IPPSVVYGTVSGKYEGSANGTSSSYHYLL-------IYRSGQINDVVIGPLKPN 113 (427)
T ss_pred CCeEEEEEECCCC-------------CCCEEEEecCCCCCcceEEEEEEEEeccc-------cccCCeEEEEEeCCCCCC
Confidence 3689999999982 46899999999999999999988887320 0123466665 7999999
Q ss_pred CEEEEEcccCCCCCCCceeEEecCCCCCCCCCCeEEEEEeecCCCCChHHHHHHHHhCCCcEEEEcCceeccCCCCCCCC
Q 047688 80 TLYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISNRPDLILLVGDVTYANLYLTNGT 159 (185)
Q Consensus 80 T~Y~Yrvg~~~~~~~S~~~~F~T~p~~~~~~~~~~f~~~GD~G~~~~~~~t~~~l~~~~~dfilh~GDlaYAd~~~~~g~ 159 (185)
|+|+||||.. .+|++|+|+|+|.. .+++|+++||||.......+++++.+.++|||||+|||+|++.+ ..
T Consensus 114 T~Y~Yrvg~~---~~s~~~~F~T~p~~----~~~~f~v~GDlG~~~~~~~tl~~i~~~~pD~vl~~GDl~y~~~~---~~ 183 (427)
T PLN02533 114 TVYYYKCGGP---SSTQEFSFRTPPSK----FPIKFAVSGDLGTSEWTKSTLEHVSKWDYDVFILPGDLSYANFY---QP 183 (427)
T ss_pred CEEEEEECCC---CCccceEEECCCCC----CCeEEEEEEeCCCCcccHHHHHHHHhcCCCEEEEcCccccccch---HH
Confidence 9999999965 46999999998864 48999999999986555567889988999999999999998654 34
Q ss_pred cccccccccC
Q 047688 160 GFDCYSCSFA 169 (185)
Q Consensus 160 ~gd~f~~~~~ 169 (185)
.+|.|++.++
T Consensus 184 ~wd~f~~~i~ 193 (427)
T PLN02533 184 LWDTFGRLVQ 193 (427)
T ss_pred HHHHHHHHhh
Confidence 5677777654
|
|
| >KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: |
Back alignment and domain information |
|---|
| >COG3540 PhoD Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 | Back alignment and domain information |
|---|
| >KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PTZ00422 glideosome-associated protein 50; Provisional | Back alignment and domain information |
|---|
| >cd07389 MPP_PhoD Bacillus subtilis PhoD and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] | Back alignment and domain information |
|---|
| >TIGR00040 yfcE phosphoesterase, MJ0936 family | Back alignment and domain information |
|---|
| >cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK09453 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >COG0622 Predicted phosphoesterase [General function prediction only] | Back alignment and domain information |
|---|
| >cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain | Back alignment and domain information |
|---|
| >PRK11340 phosphodiesterase YaeI; Provisional | Back alignment and domain information |
|---|
| >cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain | Back alignment and domain information |
|---|
| >TIGR03729 acc_ester putative phosphoesterase | Back alignment and domain information |
|---|
| >PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >TIGR00583 mre11 DNA repair protein (mre11) | Back alignment and domain information |
|---|
| >KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02546 47 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1409 Icc Predicted phosphohydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >TIGR00619 sbcd exonuclease SbcD | Back alignment and domain information |
|---|
| >COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 185 | ||||
| 1xzw_A | 426 | Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPL | 3e-05 | ||
| 4dsy_A | 426 | Crystal Structure Of Red Kidney Bean Purple Acid Ph | 3e-04 | ||
| 2qfp_A | 424 | Crystal Structure Of Red Kidney Bean Purple Acid Ph | 3e-04 | ||
| 1kbp_A | 432 | Kidney Bean Purple Acid Phosphatase Length = 432 | 3e-04 |
| >pdb|1XZW|A Chain A, Sweet Potato Purple Acid PhosphatasePHOSPHATE COMPLEX Length = 426 | Back alignment and structure |
|
| >pdb|4DSY|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase In Complex With Maybridge Fragment Cc24201 Length = 426 | Back alignment and structure |
| >pdb|2QFP|A Chain A, Crystal Structure Of Red Kidney Bean Purple Acid Phosphatase In Complex With Fluoride Length = 424 | Back alignment and structure |
| >pdb|1KBP|A Chain A, Kidney Bean Purple Acid Phosphatase Length = 432 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 185 | |||
| 1xzw_A | 426 | Purple acid phosphatase; hydrolase; HET: NAG FUC M | 8e-17 | |
| 2qfp_A | 424 | Purple acid phosphatase; binuclear, Fe-Zn, hydrola | 6e-14 |
| >1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Length = 426 | Back alignment and structure |
|---|
Score = 76.3 bits (187), Expect = 8e-17
Identities = 37/167 (22%), Positives = 69/167 (41%), Gaps = 32/167 (19%)
Query: 21 SLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCSSHILKPDT 80
+ K+ + V Y + S+ +RA + + + + H C+ L+ DT
Sbjct: 46 TPYDKAGANKVFYWSENSKSQKRAMGTVVT------YKYYNYTSAFIHH-CTIKDLEYDT 98
Query: 81 LYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISN--R 138
YYY+ G ++F T P P P ++GD+G T+++ +T++H N +
Sbjct: 99 KYYYRLGFGD---AKRQFWFVTPPKPGP-DVPYVFGLIGDIGQTHDSNTTLTHYEQNSAK 154
Query: 139 PDLILLVGDVTYANLYLTNGTGFDCYSCSFANSPIYETYQPRWDYWG 185
+L +GD++Y+N + + RWD WG
Sbjct: 155 GQAVLFMGDLSYSNRWPNH-------------------DNNRWDTWG 182
|
| >2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Length = 424 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| 2qfp_A | 424 | Purple acid phosphatase; binuclear, Fe-Zn, hydrola | 99.91 | |
| 1xzw_A | 426 | Purple acid phosphatase; hydrolase; HET: NAG FUC M | 99.9 | |
| 2yeq_A | 527 | Apased, PHOD, alkaline phosphatase D; hydrolase, p | 99.7 | |
| 1ute_A | 313 | Protein (II purple acid phosphatase); tartrate res | 97.44 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 97.07 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 97.02 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 97.0 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 96.98 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 96.89 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 96.75 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 96.73 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 96.68 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 96.67 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 96.67 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 96.66 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 96.63 | |
| 3tgh_A | 342 | Glideosome-associated protein 50; phosphatase fold | 96.62 | |
| 3ib7_A | 330 | ICC protein; metallophosphoesterase, alpha-beta fo | 96.55 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 96.52 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 96.32 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 96.32 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 96.3 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 96.26 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 96.2 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 96.16 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 96.02 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 96.0 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 95.97 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 95.89 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 95.87 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 95.76 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 95.74 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 95.72 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 95.72 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 95.7 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 95.7 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 95.67 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 95.67 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 95.62 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 95.47 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 95.44 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 95.38 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 95.37 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 95.34 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 95.31 | |
| 2nxf_A | 322 | Putative dimetal phosphatase; dinuclear metal cent | 95.26 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 95.26 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 95.18 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 95.14 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 95.12 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 95.05 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 95.0 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 94.94 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 94.92 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 94.88 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 94.87 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 94.86 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 94.86 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 94.83 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 94.73 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 94.71 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 94.67 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 94.65 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 94.64 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 94.62 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 94.61 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 94.59 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 94.5 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 94.48 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 94.28 | |
| 2yvt_A | 260 | Hypothetical protein AQ_1956; structural genomics, | 94.23 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 94.22 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 94.2 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 94.2 | |
| 1uf3_A | 228 | Hypothetical protein TT1561; metallo-dependent pho | 94.1 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 93.99 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 93.99 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 93.98 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 93.92 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 93.84 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 93.68 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 93.64 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 93.45 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 93.44 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 93.36 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 93.32 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 93.22 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 93.21 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 93.2 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 93.17 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 93.15 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 93.15 | |
| 3d03_A | 274 | Phosphohydrolase; glycerophosphodiesterase, metall | 93.11 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 93.09 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 93.04 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 93.0 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 92.89 | |
| 2xmo_A | 443 | LMO2642 protein; phosphodiesterase, hydrolase; 1.7 | 92.85 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 92.72 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 92.64 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 92.63 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 92.52 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 92.46 | |
| 1s3l_A | 190 | Hypothetical protein MJ0936; phosphodiesterase, nu | 92.1 | |
| 3qfm_A | 270 | SAPH, putative uncharacterized protein; sandwich f | 91.94 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 91.85 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 91.77 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 91.58 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 91.46 | |
| 3ck2_A | 176 | Conserved uncharacterized protein (predicted phosp | 91.4 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 91.37 | |
| 3av0_A | 386 | DNA double-strand break repair protein MRE11; DNA | 91.22 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 91.16 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 91.13 | |
| 2a22_A | 215 | Vacuolar protein sorting 29; alpha-beta-BETA-alpha | 91.01 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 90.72 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 90.18 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 90.03 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 89.92 | |
| 2kkn_A | 178 | Uncharacterized protein; protein phosphatase 2A ho | 89.91 | |
| 1ii7_A | 333 | MRE11 nuclease; RAD50, DNA double-strand break rep | 89.82 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 89.8 | |
| 1z2w_A | 192 | Vacuolar protein sorting 29; VPS29, retromer, phos | 89.69 | |
| 1nnw_A | 252 | Hypothetical protein; structural genomics, PSI, pr | 89.6 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 89.43 | |
| 1su1_A | 208 | Hypothetical protein YFCE; structural genomics, ph | 89.32 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 89.24 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 89.21 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 88.28 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 88.23 | |
| 4fbw_A | 417 | DNA repair protein RAD32; DNA double-strand break | 88.18 | |
| 4fbk_A | 472 | DNA repair and telomere maintenance protein NBS1, | 88.03 | |
| 3csg_A | 461 | MBP, maltose-binding protein monobody YS1 fusion, | 87.97 | |
| 1xm7_A | 195 | Hypothetical protein AQ_1665; structural genomics, | 87.92 | |
| 3t1i_A | 431 | Double-strand break repair protein MRE11A; DNA rep | 87.64 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 87.43 | |
| 2q8u_A | 336 | Exonuclease, putative; structural genomics, joint | 87.21 | |
| 3rqz_A | 246 | Metallophosphoesterase; PSI-biology, midwest cente | 86.89 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 86.83 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 86.43 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 86.43 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 86.38 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 85.9 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 85.81 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 85.6 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 85.58 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 85.52 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 85.04 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 84.68 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 84.66 | |
| 3tho_B | 379 | Exonuclease, putative; adenosine triphosphate, bac | 84.04 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 83.64 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 83.51 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 83.2 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 82.56 | |
| 1g5b_A | 221 | Serine/threonine protein phosphatase; bacteriophag | 82.29 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 81.94 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 80.67 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 80.4 |
| >2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* | Back alignment and structure |
|---|
Probab=99.91 E-value=1e-23 Score=185.29 Aligned_cols=129 Identities=24% Similarity=0.356 Sum_probs=104.2
Q ss_pred ceEEEEEEcCCCccccccccCCCCCCccEEEEeccCCCCCeEEEEEEEeeccccCccCCCCCCccceEEee-eCCCCCCC
Q 047688 2 YIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCS-SHILKPDT 80 (185)
Q Consensus 2 ~~m~VsW~T~~~~~~~~~~~~~p~~~~s~V~yG~~~~~l~~~a~g~~~~y~~~~~~~~~~~~G~~~y~h~v-l~gL~P~T 80 (185)
++|+|+|+|... ...+.|+||++++.+..++.|++++|... .....|+|.| ++||+|+|
T Consensus 32 ~~~~v~W~t~~~------------~~~~~V~~~~~~~~~~~~~~g~~~~~~~~--------~~~~~~~~~v~l~gL~p~t 91 (424)
T 2qfp_A 32 RAMIISWVTMDE------------PGSSAVRYWSEKNGRKRIAKGKMSTYRFF--------NYSSGFIHHTTIRKLKYNT 91 (424)
T ss_dssp SCEEEEEEESSS------------CCCCCEEEEESSSCCCEEECCEEECCBCS--------SCBCCEEEEEEECSCCTTC
T ss_pred CeEEEEEECCCC------------CCCCEEEEEeCCCCCceEEEEEEEEEEec--------CCCCCEEEEEEECCCCCCC
Confidence 589999999772 35789999999998988999988877642 0123466655 79999999
Q ss_pred EEEEEcccCCCCCCCceeEEecCCCCCCCCCCeEEEEEeecCCCCChHHHHHHHHhC--CCcEEEEcCceeccCCC
Q 047688 81 LYYYQCGDPSIPAMSGTYYFRTMPDSSPTSYPSRIAIVGDVGLTYNTTSTVSHMISN--RPDLILLVGDVTYANLY 154 (185)
Q Consensus 81 ~Y~Yrvg~~~~~~~S~~~~F~T~p~~~~~~~~~~f~~~GD~G~~~~~~~t~~~l~~~--~~dfilh~GDlaYAd~~ 154 (185)
+|+|||+.+ .+|++++|+|+|.+++ ..+++|+++||+|...+...+++++.+. ++|||||+||++|+++.
T Consensus 92 ~Y~Yrv~~~---~~s~~~~f~T~p~~~~-~~~~~f~~igD~~~~~~~~~~l~~~~~~~~~~D~vl~~GDl~y~~~~ 163 (424)
T 2qfp_A 92 KYYYEVGLR---NTTRRFSFITPPQTGL-DVPYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRY 163 (424)
T ss_dssp EEEEEECCS---SSCEEEEEECCCCCCT-TCCEEEEEECSCTTBHHHHHHHHHHHTCSSCCCEEEECSCCSCGGGS
T ss_pred EEEEEECCC---CccceEEEECCCCCCC-CCCeEEEEEEeCCCCCChHHHHHHHHhCCCCCCEEEEcCcccccccc
Confidence 999999986 5899999999998753 3589999999999754444567777765 89999999999998654
|
| >1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 | Back alignment and structure |
|---|
| >2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A | Back alignment and structure |
|---|
| >3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A | Back alignment and structure |
|---|
| >1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* | Back alignment and structure |
|---|
| >4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* | Back alignment and structure |
|---|
| >3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* | Back alignment and structure |
|---|
| >1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 | Back alignment and structure |
|---|
| >3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A | Back alignment and structure |
|---|
| >3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 185 | ||||
| d2qfra2 | 312 | d.159.1.1 (A:121-432) Plant purple acid phosphatas | 1e-07 | |
| d2qfra1 | 112 | b.1.12.1 (A:9-120) Purple acid phosphatase, N-term | 1e-06 | |
| d1xzwa1 | 119 | b.1.12.1 (A:1-119) Purple acid phosphatase, N-term | 1e-05 |
| >d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 312 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Metallo-dependent phosphatases superfamily: Metallo-dependent phosphatases family: Purple acid phosphatase-like domain: Plant purple acid phosphatase, catalytic domain species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Score = 48.0 bits (113), Expect = 1e-07
Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 21/76 (27%)
Query: 112 PSRIAIVGDVGLTYNTTSTVSHMI--SNRPDLILLVGDVTYANLYLTNGTGFDCYSCSFA 169
P ++GD+G ++++ +T+SH + +L VGD++YA+ Y +
Sbjct: 7 PYTFGLIGDLGQSFDSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNH------------ 54
Query: 170 NSPIYETYQPRWDYWG 185
RWD WG
Sbjct: 55 -------DNVRWDTWG 63
|
| >d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 112 | Back information, alignment and structure |
|---|
| >d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Length = 119 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 185 | |||
| d2qfra1 | 112 | Purple acid phosphatase, N-terminal domain {Kidney | 99.82 | |
| d1xzwa1 | 119 | Purple acid phosphatase, N-terminal domain {Sweet | 99.81 | |
| d2qfra2 | 312 | Plant purple acid phosphatase, catalytic domain {K | 98.75 | |
| d1utea_ | 302 | Mammalian purple acid phosphatase {Pig (Sus scrofa | 97.95 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 97.66 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 97.55 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 97.55 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 97.33 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 97.28 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 97.21 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 97.21 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 97.08 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 96.94 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.93 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 96.89 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 96.83 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 96.81 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 96.75 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 96.7 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 96.67 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 96.66 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 96.65 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 96.63 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 96.62 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 96.55 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 96.51 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 96.48 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 96.48 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 96.47 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 96.45 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 96.43 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 96.43 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 96.42 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 96.42 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 96.42 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 96.4 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 96.4 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 96.4 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 96.39 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 96.33 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 96.29 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 96.22 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 96.21 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 96.19 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 96.11 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 96.06 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 96.05 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 96.05 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 96.04 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 96.01 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.0 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 95.86 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 95.82 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 95.78 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 95.78 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 95.75 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 95.74 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 95.73 | |
| d2yvta1 | 257 | Uncharacterized protein Aq_1956 {Aquifex aeolicus | 95.61 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 95.59 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 95.51 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 95.5 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 95.49 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 95.41 | |
| d2nxfa1 | 320 | Uncharacterized C17orf48 homolog zgc:64213 {Zebraf | 95.35 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 95.24 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 95.23 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 95.17 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 95.12 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 94.93 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 94.86 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 94.75 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 94.53 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 94.53 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 94.45 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 94.34 | |
| d1s3la_ | 165 | Putative phosphodiesterase MJ0936 {Methanococcus j | 94.33 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 94.07 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 93.43 | |
| d1su1a_ | 184 | Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 | 93.43 | |
| d2hy1a1 | 256 | Rv0805 cyclic nucleotide phosphodiesterase {Mycoba | 93.13 | |
| d3ck2a1 | 173 | Uncharacterized protein SP1879 {Streptococcus pneu | 92.8 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 92.59 | |
| d1uf3a_ | 228 | Hypothetical protein TT1561 {Thermus thermophilus | 92.55 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 92.52 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 92.21 | |
| d1z2wa1 | 182 | Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus | 91.91 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 91.79 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 91.68 | |
| d1ii7a_ | 333 | Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 91.18 | |
| d2a22a1 | 193 | Vacuolar protein sorting 29, VPS29 {Cryptosporidiu | 89.93 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 89.71 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 89.66 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 89.08 | |
| d1nnwa_ | 251 | Hypothetical protein PF1291 {Archaeon Pyrococcus f | 88.28 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 86.62 | |
| d3d03a1 | 271 | Glycerophosphodiesterase GpdQ {Enterobacter aeroge | 85.92 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 84.8 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 82.43 |
| >d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Purple acid phosphatase, N-terminal domain family: Purple acid phosphatase, N-terminal domain domain: Purple acid phosphatase, N-terminal domain species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.82 E-value=3.6e-20 Score=135.05 Aligned_cols=80 Identities=21% Similarity=0.184 Sum_probs=65.7
Q ss_pred ceEEEEEEcCCCccccccccCCCCCCccEEEEeccCCCCCeEEEEEEEeeccccCccCCCCCCccceEEee-eCCCCCCC
Q 047688 2 YIVWINEFAGEFQIGNNIKSLNPKSVTSVVRYGTLRSQLNRRATCHSLVSNQLYPFFRPSKLHLWNHTQCS-SHILKPDT 80 (185)
Q Consensus 2 ~~m~VsW~T~~~~~~~~~~~~~p~~~~s~V~yG~~~~~l~~~a~g~~~~y~~~~~~~~~~~~G~~~y~h~v-l~gL~P~T 80 (185)
++|+|+|+|... ...+.|+||++++.+..++.|...+|... . ....|+|.| |+||+|+|
T Consensus 32 tsm~VsW~T~~~------------~~~~~V~yg~~~~~~~~~a~~~~~~~~~~-------~-~~~~~~h~v~Lt~L~P~T 91 (112)
T d2qfra1 32 RAMIISWVTMDE------------PGSSAVRYWSEKNGRKRIAKGKMSTYRFF-------N-YSSGFIHHTTIRKLKYNT 91 (112)
T ss_dssp SCEEEEEEESSS------------CCCCEEEEEESSSCCCEEEECEEECCBCS-------S-CBCCEEEEEEECSCCTTC
T ss_pred CEEEEEEECCCC------------CCCcEEEEEECCCCCCcEEEEEEEEEEec-------c-cCCcEEEEEEECCCCCCC
Confidence 589999999761 46899999999999999999998877632 1 122355555 79999999
Q ss_pred EEEEEcccCCCCCCCceeEEecCC
Q 047688 81 LYYYQCGDPSIPAMSGTYYFRTMP 104 (185)
Q Consensus 81 ~Y~Yrvg~~~~~~~S~~~~F~T~p 104 (185)
+|+||||++ +||++|+|+|+|
T Consensus 92 ~Y~YrVG~~---~~S~~~~F~T~P 112 (112)
T d2qfra1 92 KYYYEVGLR---NTTRRFSFITPP 112 (112)
T ss_dssp EEEEEECCS---SSCEEEEEECCC
T ss_pred EEEEEECCC---CceeeEEEEcCC
Confidence 999999975 699999999987
|
| >d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} | Back information, alignment and structure |
|---|
| >d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|