Citrus Sinensis ID: 047710

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----

MEITYNYFDNSDAHLPPGFRFHPTDEELITYYLLKKVLDCNFTGRAIAEVDLNKCEPWELPAKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSSKTCALVGMKKTLVFYRGRAPKGEKSNWVMHEYRLEGKFAYQYLSRSSKDEWVISRVFQKSSGAIATAAAVANAVKKSRLSCTISSSSTFNHSYPEPSSPSSVSLPPLLDHPTIAAAANATTAPNDSCSYDESHAPSDQHVSCFSTIAAAAAAAAASAATATTFNTSSSAFDFTTVPAPVINADAGAGAACDPFARFGRNNVGLNAFPNLRSLQENLQLPFFFAPPASSVAPPPFQGGGGGSNWSTVMQDIGGGGGVVGGGGRLNVGPTELDCMWTY

ccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEcccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccccccccccEEEEEEcccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccc

*************HLPPGFRFHPTDEELITYYLLKKVLDCNFTGRAIAEVDLNKCEPWELPAKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSSKTCALVGMKKTLVFYRGRAPKGEKSNWVMHEYRLEGKFA***LSRSSKDEWVISRVFQKSS****************************************************************************************************TFNTSSSAFDFTTVPAPVINADAGAGAACDPFARFGRNNVGLNAFPNLRSLQENLQLPFFFA*********************************************ELDCMWTY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein CUP-SHAPED COTYLEDON 2	Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division.	probable	O04017

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ULX, chain A
Confidence level:very confident
Coverage over the Query: 10-169
View the alignment between query and template
View the model in PyMOL