Citrus Sinensis ID: 047717


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300---
MALIVICGQPSSGKSLAATCLAEALKESEAKETVRIIDEASFHLDRNQSYASMPAEKNLRGVLRSEVDRSVSKDNIIIVDSLNSIKGYRYELWCLARAAGIRYCVLYCDLEEDHCRKWNKERHEKGEAAYDDKIFEDLVRRFEKPDRRNRWDSPLFELCPYKDAIENSSAAILDAVAYLTKKVDSKSRDVKILQPTIATQNTRFSEANSLYELDRATQEVINAVVEAQSKALGGPMNGISLGQGLPNISISRSVGLPELRRLRRTFIKLTGQTSLSGPPPPSDADSAKRMFVDYLNRELETTV
cEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccccccccEEccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccc
MALIVICGQPSSGKSLAATCLAEALKESEAKETVRIIDEASFHLDRNQSYASMPAEKNLRGVLRSEVDRSVSKDNIIIVDSLNSIKGYRYELWCLARAAGIRYCVLYCDLEEDHCRKWNKERHEKGEAAYDDKIFEDLVRRFEKPDRRNRWDSPLFELCPYKDAIENSSAAILDAVAYLTKKVDSKSRDVKILQPTIATQNTRFSEANSLYELDRATQEVINAVVEAQSKALGGPMNGISLGQGLPNISISRSVGLPELRRLRRTFIKLTGQT***********DSAKRMFVDYLNRELE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALIVICGQPSSGKSLAATCLAEALKESEAKETVRIIDEASFHLDRNQSYASMPAEKNLRGVLRSEVDRSVSKDNIIIVDSLNSIKGYRYELWCLARAAGIRYCVLYCDLEEDHCRKWNKERHEKGEAAYDDKIFEDLVRRFEKPDRRNRWDSPLFELCPYKDAIENSSAAILDAVAYLTKKVDSKSRDVKILQPTIATQNTRFSEANSLYELDRATQEVINAVVEAQSKALGGPMNGISLGQGLPNISISRSVGLPELRRLRRTFIKLTGQTSLSGPPPPSDADSAKRMFVDYLNRELETTV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein KTI12 homolog probableQ0P457
Protein kti12 Elongator-associated factor that is not a structural subunit but rather transiently contacts Elongator, presumably to promote its interaction with elongation competent pol II. Required for an early step in synthesis of 5-methoxycarbonylmethyl (mcm5) and 5-carbamoylmethyl (ncm5) groups present on uridines at the wobble position in tRNA.probableQ9P7V4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A4M, chain A
Confidence level:very confident
Coverage over the Query: 1-201,213-231,253-298
View the alignment between query and template
View the model in PyMOL