Citrus Sinensis ID: 047772

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MTGEALQISPANDPRGSPAKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGALANISNTETNISAYLLLDFEFYLQHFSFLDSFRHTQSGFSLSPKPFFSNFGAIVTFAIFGTFLASMVTGILVYLGGVMFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMAISLYRTMSLVRSHASSGQNFFMVIVRFLETFVGSILQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTFSNLSENSQRFVSAFFHLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILFIIVARAANVFSCAYLVNLARPAHRQIPLKHQQALWYSGLRGAMAFALALQSVHDLPEGHGQTIFSATTVIVVLTVLLIGGSTGTMLEALQVVGDAHDGHLGENFEGNNGYAAPYDEGSTSGNKLKMKLKEFRKSAASFTALDKNYLTPFFTSHNGDEEDEEDGKIG
cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccHHHcccHHHHHHHHcccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEEccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccHHHHHHHHHHHccccccccccccEEHHcHHHHHHHHHHHcccHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc
************************AGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGALANISNTETNISAYLLLDFEFYLQHFSFLDSFRHTQSGFSLSPKPFFSNFGAIVTFAIFGTFLASMVTGILVYLGGVMFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMAISLYRTMSLVRSHASSGQNFFMVIVRFLETFVGSILQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTFSNLSENSQRFVSAFFHLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILFIIVARAANVFSCAYLVNLARPAHRQIPLKHQQALWYSGLRGAMAFALALQSVHDLPEGHGQTIFSATTVIVVLTVLLIGGSTGTMLEALQVVG**********F*************************EFRKSAASFTALDKNYLTPFF****************
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGEALQISPANDPRGSPAKEQQAAGVGILLQIMMLVLSFVLGHVLRRHKFYYLPEASASLLIGLIVGALANISNTETNISAYLLLDFEFYLQHFSFLDSFRHTQSGFSLSPKPFFSNFGAIVTFAIFGTFLASMVTGILVYLGGVMFLMYRLPFVECLMFGALISATDPVTVLSIFQELGTDMNLYALVFGESVLNDAMAISLYRTMSLVRSHASSGQNFFMVIVRFLETFVGSILQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTGIVMKRYTFSNLSENSQRFVSAFFHLISSLAETFVFIYMGFDIAMEKHSWSHLGFIFFSILFIIVARAANVFSCAYLVNLARPAHRQIPLKHQQALWYSGLRGAMAFALALQSVHDLPEGHGQTIFSATTVIVVLTVLLIGGSTGTMLEALQVVGDAHDGHLGENFEGNNGYAAPYDEGSTSGNKLKMKLKEFRKSAASFTALDKNYLTPFFTSHNGDEEDEEDGKIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/hydrogen exchanger 6 Involved in trafficking to the vacuole. Required for cell proliferation and cell expansion, but not for cell differentiation. May act in low affinity electroneutral exchange of protons for cations such as Na(+) or K(+) across membranes. May also exchange Li(+) and Cs(+) with a lower affinity.confidentQ8RWU6
Sodium/hydrogen exchanger 8 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.probableQ5ZJ75
Sodium/hydrogen exchanger 5 Involved in trafficking to the vacuole. Required for cell proliferation and cell expansion, but not for cell differentiation. Acts in low affinity electroneutral exchange of protons for cations such as Na(+) or K(+) across membranes. May also exchange Li(+) and Cs(+) with a lower affinity.probableQ8S396

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZCD, chain A
Confidence level:confident
Coverage over the Query: 96-384
View the alignment between query and template
View the model in PyMOL