Citrus Sinensis ID: 047783

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
NPRIKIDQKSHHSATVQTIILNWTPISHRFSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGKSLHLL
cccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEcccccccccHHHHHHHcccEEEcccccccccccEEcc
********KSHHSATVQTIILNWTPISHRFSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGKSLHLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPRIKIDQKSHHSATVQTIILNWTPISHRFSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGKSLHLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenine phosphoribosyltransferase 1, chloroplastic Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.probableP31166

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DY0, chain A
Confidence level:very confident
Coverage over the Query: 7-87
View the alignment between query and template
View the model in PyMOL