Citrus Sinensis ID: 047783

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
NPRIKIDQKSHHSATVQTIILNWTPISHRFSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGKSLHLL
cccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccEEEEcccccccccHHHHHHHcccEEEcccccccccccEEcc
cccEEEEcccccccEEEEEEEEcccHHcccHHHHHHHHHHEHEccccccEEEEEcccHHHHHHHHHHHHccEEEEEEEcccccccEEEEc
nprikidqkshhsATVQTIILNWTPISHRFSVSLSFrhklfsepspsvrflqgikargfifgppiawaigakfvpmrkpkklpgkslhll
nprikidqkshhsaTVQTIILNWTPISHRFSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIgakfvpmrkpkklpgkslhll
NPRIKIDQKSHHSATVQTIILNWTPISHRFSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGKSLHLL
*************ATVQTIILNWTPISHRFSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGAKFVP***************
********KSHHSATVQTIILNWTPISHRFSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGKSLHLL
**************TVQTIILNWTPISHRFSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPK**********
NPRIKIDQKSHHSATVQTIILNWTPISHRFSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGKSLHLL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPRIKIDQKSHHSATVQTIILNWTPISHRFSVSLSFRHKLFSEPSPSVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGKSLHLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query90 2.2.26 [Sep-21-2011]
P31166243 Adenine phosphoribosyltra yes no 0.422 0.156 0.789 7e-12
Q43199181 Adenine phosphoribosyltra N/A no 0.588 0.292 0.578 5e-11
Q42563192 Adenine phosphoribosyltra no no 0.722 0.338 0.424 1e-10
B2TMZ9172 Adenine phosphoribosyltra yes no 0.5 0.261 0.533 2e-08
Q6CA53182 Adenine phosphoribosyltra yes no 0.4 0.197 0.666 3e-08
B2V345172 Adenine phosphoribosyltra yes no 0.5 0.261 0.511 3e-08
Q756E2187 Adenine phosphoribosyltra yes no 0.466 0.224 0.547 7e-08
Q01QQ9173 Adenine phosphoribosyltra yes no 0.466 0.242 0.571 9e-08
Q1IKJ1182 Adenine phosphoribosyltra yes no 0.477 0.236 0.465 1e-07
B0CBF7170 Adenine phosphoribosyltra yes no 0.411 0.217 0.594 2e-07
>sp|P31166|APT1_ARATH Adenine phosphoribosyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=APT1 PE=1 SV=2 Back     alignment and function desciption
 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 30/38 (78%), Positives = 34/38 (89%)

Query: 48  VRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGK 85
           +  + G++ARGFIFGPPIA AIGAKFVPMRKPKKLPGK
Sbjct: 120 ISVVAGVEARGFIFGPPIALAIGAKFVPMRKPKKLPGK 157
Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 7
>sp|Q43199|APT1_WHEAT Adenine phosphoribosyltransferase 1 OS=Triticum aestivum GN=APT1 PE=2 SV=1 Back     alignment and function description
>sp|Q42563|APT2_ARATH Adenine phosphoribosyltransferase 2 OS=Arabidopsis thaliana GN=APT2 PE=2 SV=1 Back     alignment and function description
>sp|B2TMZ9|APT_CLOBB Adenine phosphoribosyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|Q6CA53|APT_YARLI Adenine phosphoribosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=APT1 PE=3 SV=1 Back     alignment and function description
>sp|B2V345|APT_CLOBA Adenine phosphoribosyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|Q756E2|APT_ASHGO Adenine phosphoribosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=APT1 PE=3 SV=1 Back     alignment and function description
>sp|Q01QQ9|APT_SOLUE Adenine phosphoribosyltransferase OS=Solibacter usitatus (strain Ellin6076) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|Q1IKJ1|APT_KORVE Adenine phosphoribosyltransferase OS=Koribacter versatilis (strain Ellin345) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|B0CBF7|APT_ACAM1 Adenine phosphoribosyltransferase OS=Acaryochloris marina (strain MBIC 11017) GN=apt PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
449465856186 PREDICTED: adenine phosphoribosyltransfe 0.466 0.225 0.714 2e-10
18396344 243 adenine phosphoribosyltransferase 1 [Ara 0.422 0.156 0.789 3e-10
408455889151 adenine phosphoribosyl transferase, part 0.966 0.576 0.412 3e-10
30689934183 adenine phosphoribosyltransferase 1 [Ara 0.455 0.224 0.731 4e-10
297845694 242 hypothetical protein ARALYDRAFT_472949 [ 0.422 0.157 0.789 4e-10
32492063 204 adenine phosphoribosyltransferase [Brass 0.455 0.200 0.731 4e-10
168033874184 predicted protein [Physcomitrella patens 0.655 0.320 0.529 4e-10
334182907 284 adenine phosphoribosyltransferase 1 [Ara 0.466 0.147 0.738 5e-10
449450275 260 PREDICTED: adenine phosphoribosyltransfe 0.455 0.157 0.731 6e-10
3776082141 MtN30 [Medicago truncatula] 0.455 0.290 0.731 7e-10
>gi|449465856|ref|XP_004150643.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like [Cucumis sativus] gi|449514692|ref|XP_004164453.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%)

Query: 47  SVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGKSLH 88
           ++  + GI+ARGFIFGPPIA AIGAKFVP+RKPKKLPG+ +H
Sbjct: 61  NISVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGEVMH 102

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|18396344|ref|NP_564284.1| adenine phosphoribosyltransferase 1 [Arabidopsis thaliana] gi|38503396|sp|P31166.2|APT1_ARATH RecName: Full=Adenine phosphoribosyltransferase 1, chloroplastic; Short=APRT 1; Flags: Precursor gi|21536559|gb|AAM60891.1| adenine phosphoribosyltransferase 1, APRT [Arabidopsis thaliana] gi|332192710|gb|AEE30831.1| adenine phosphoribosyltransferase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|408455889|gb|AFU67074.1| adenine phosphoribosyl transferase, partial [Solanum melongena] Back     alignment and taxonomy information
>gi|30689934|ref|NP_849714.1| adenine phosphoribosyltransferase 1 [Arabidopsis thaliana] gi|11762238|gb|AAG40397.1|AF325045_1 At1g27450 [Arabidopsis thaliana] gi|16164|emb|CAA41497.1| adenine phosphoribosyltransferase [Arabidopsis thaliana] gi|433050|gb|AAA20677.1| adenine phosphoribosyltransferase [Arabidopsis thaliana] gi|22135996|gb|AAM91580.1| adenine phosphoribosyltransferase 1, APRT [Arabidopsis thaliana] gi|23198324|gb|AAN15689.1| adenine phosphoribosyltransferase 1, APRT [Arabidopsis thaliana] gi|332192711|gb|AEE30832.1| adenine phosphoribosyltransferase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297845694|ref|XP_002890728.1| hypothetical protein ARALYDRAFT_472949 [Arabidopsis lyrata subsp. lyrata] gi|297336570|gb|EFH66987.1| hypothetical protein ARALYDRAFT_472949 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|32492063|gb|AAP85303.1| adenine phosphoribosyltransferase [Brassica napus] Back     alignment and taxonomy information
>gi|168033874|ref|XP_001769439.1| predicted protein [Physcomitrella patens subsp. patens] gi|71835969|gb|AAZ42360.1| adenine phosphoribosyltransferase [Physcomitrella patens] gi|162679359|gb|EDQ65808.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|334182907|ref|NP_001185104.1| adenine phosphoribosyltransferase 1 [Arabidopsis thaliana] gi|332192712|gb|AEE30833.1| adenine phosphoribosyltransferase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449450275|ref|XP_004142889.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like [Cucumis sativus] gi|449522831|ref|XP_004168429.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|3776082|emb|CAA77094.1| MtN30 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
TAIR|locus:2127480183 APT3 "adenine phosphoribosyl t 0.455 0.224 0.682 1.3e-11
TAIR|locus:2016309192 APT2 "adenine phosphoribosyl t 0.433 0.203 0.692 7.4e-11
TAIR|locus:2135550182 APT4 "adenine phosphoribosyl t 0.433 0.214 0.717 1.2e-10
TAIR|locus:2147967191 APT5 "adenine phosphoribosyltr 0.711 0.335 0.428 2.5e-10
SGD|S000004484187 APT1 "Adenine phosphoribosyltr 0.466 0.224 0.476 2.3e-07
CGD|CAL0004599188 APT1 [Candida albicans (taxid: 0.411 0.196 0.540 3.8e-07
SGD|S000002849181 APT2 "Potential adenine phosph 0.422 0.209 0.526 1e-06
UNIPROTKB|P69503183 apt "adenine phosphoribosyltra 0.388 0.191 0.542 2.2e-06
WB|WBGene00020557185 T19B4.3 [Caenorhabditis elegan 0.388 0.189 0.542 2.3e-06
POMBASE|SPAC23A1.03188 apt1 "adenine phosphoribosyltr 0.422 0.202 0.5 2.5e-06
TAIR|locus:2127480 APT3 "adenine phosphoribosyl transferase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 158 (60.7 bits), Expect = 1.3e-11, P = 1.3e-11
 Identities = 28/41 (68%), Positives = 37/41 (90%)

Query:    47 SVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGKSL 87
             ++  + GI+ARGF+FGPPIA AIGAKFVP+RKPKKLPG+++
Sbjct:    60 NISVVAGIEARGFLFGPPIALAIGAKFVPLRKPKKLPGETI 100
GO:0003999 "adenine phosphoribosyltransferase activity" evidence=IEA;ISS;IDA
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0006168 "adenine salvage" evidence=IEA;TAS
GO:0009116 "nucleoside metabolic process" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2016309 APT2 "adenine phosphoribosyl transferase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135550 APT4 "adenine phosphoribosyl transferase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147967 APT5 "adenine phosphoribosyltransferase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000004484 APT1 "Adenine phosphoribosyltransferase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0004599 APT1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
SGD|S000002849 APT2 "Potential adenine phosphoribosyltransferase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|P69503 apt "adenine phosphoribosyltransferase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
WB|WBGene00020557 T19B4.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPAC23A1.03 apt1 "adenine phosphoribosyltransferase (APRT) (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P31166APT1_ARATH2, ., 4, ., 2, ., 70.78940.42220.1563yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
F17L21.24
APT1 (ADENINE PHOSPHORIBOSYL TRANSFERASE 1); adenine phosphoribosyltransferase; Adenosine phosphoribosyl transferase(E.C-2.4.2.7), involved in the one-step salvage of adenine to AMP. ; Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis (243 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
APT5
APT5 (Adenine phosphoribosyltransferase 5); adenine phosphoribosyltransferase; Adenine phosphor [...] (191 aa)
  • ••••0.991
APT3
APT3 (ADENINE PHOSPHORIBOSYL TRANSFERASE 3); adenine phosphoribosyltransferase; Encodes an aden [...] (183 aa)
  • •• •0.991
At3g09820
ADK1 (adenosine kinase 1); adenosine kinase/ copper ion binding; Involved in the salvage synthe [...] (344 aa)
   • •• 0.960
AT1G63660
GMP synthase (glutamine-hydrolyzing), putative / glutamine amidotransferase, putative; GMP synt [...] (534 aa)
   • •• 0.949
AT5G35170
adenylate kinase family protein; adenylate kinase family protein; FUNCTIONS IN- nucleobase, nuc [...] (588 aa)
     •• 0.925
FAC1
FAC1 (EMBRYONIC FACTOR1); AMP deaminase; Encodes a protein with in vitro AMP deaminase activity [...] (839 aa)
     •• 0.921
ADK2
ADK2 (ADENOSINE KINASE 2); adenosine kinase/ copper ion binding / kinase; Encodes adenosine kin [...] (345 aa)
   • •  0.918
AT3G06200
guanylate kinase, putative; guanylate kinase, putative; FUNCTIONS IN- guanylate kinase activity [...] (282 aa)
     •• 0.918
AT2G35040
AICARFT/IMPCHase bienzyme family protein; AICARFT/IMPCHase bienzyme family protein; FUNCTIONS I [...] (596 aa)
•    •• 0.917
AT4G13720
inosine triphosphate pyrophosphatase, putative / HAM1 family protein; inosine triphosphate pyro [...] (206 aa)
   • •• 0.908

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
PLN02293187 PLN02293, PLN02293, adenine phosphoribosyltransfer 6e-19
PRK02304175 PRK02304, PRK02304, adenine phosphoribosyltransfer 4e-12
TIGR01090169 TIGR01090, apt, adenine phosphoribosyltransferase 6e-12
COG0503179 COG0503, Apt, Adenine/guanine phosphoribosyltransf 2e-07
cd06223130 cd06223, PRTases_typeI, Phosphoribosyl transferase 0.001
>gnl|CDD|177930 PLN02293, PLN02293, adenine phosphoribosyltransferase Back     alignment and domain information 
 Score = 76.3 bits (188), Expect = 6e-19
 Identities = 28/33 (84%), Positives = 31/33 (93%)

Query: 53  GIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGK 85
           GI+ARGFIFGPPIA AIGAKFVP+RKP KLPG+
Sbjct: 68  GIEARGFIFGPPIALAIGAKFVPLRKPGKLPGE 100

Length = 187
>gnl|CDD|235028 PRK02304, PRK02304, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233267 TIGR01090, apt, adenine phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|223577 COG0503, Apt, Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|206754 cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 90
KOG1712183 consensus Adenine phosphoribosyl transferases [Nuc 99.95
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and 99.78
PLN02293187 adenine phosphoribosyltransferase 99.7
TIGR01090169 apt adenine phosphoribosyltransferase. A phylogene 99.35
PRK09219189 xanthine phosphoribosyltransferase; Validated 99.29
TIGR01744191 XPRTase xanthine phosphoribosyltransferase. This m 99.19
PRK09213271 pur operon repressor; Provisional 99.17
TIGR01743268 purR_Bsub pur operon repressor, Bacillus subtilis 99.15
PRK02304175 adenine phosphoribosyltransferase; Provisional 99.07
PRK13810187 orotate phosphoribosyltransferase; Provisional 99.03
PRK12560187 adenine phosphoribosyltransferase; Provisional 98.87
PRK13809206 orotate phosphoribosyltransferase; Provisional 98.81
PRK08558238 adenine phosphoribosyltransferase; Provisional 98.72
PRK05500477 bifunctional orotidine 5'-phosphate decarboxylase/ 98.45
PRK06031 233 phosphoribosyltransferase; Provisional 98.42
PRK13811170 orotate phosphoribosyltransferase; Provisional 98.34
PRK02277200 orotate phosphoribosyltransferase-like protein; Pr 98.33
PRK00455202 pyrE orotate phosphoribosyltransferase; Validated 98.24
PRK07322178 adenine phosphoribosyltransferase; Provisional 98.14
PRK13812176 orotate phosphoribosyltransferase; Provisional 98.04
TIGR01367187 pyrE_Therm orotate phosphoribosyltransferase, Ther 97.99
TIGR00336173 pyrE orotate phosphoribosyltransferase. The conser 97.94
PRK09177156 xanthine-guanine phosphoribosyltransferase; Valida 97.32
PF00156125 Pribosyltran: Phosphoribosyl transferase domain; I 97.25
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleo 95.34
PRK01259 309 ribose-phosphate pyrophosphokinase; Provisional 95.04
COG0461201 PyrE Orotate phosphoribosyltransferase [Nucleotide 94.88
TIGR01251 308 ribP_PPkin ribose-phosphate pyrophosphokinase. In 94.19
PRK00934285 ribose-phosphate pyrophosphokinase; Provisional 91.81
PLN02238 189 hypoxanthine phosphoribosyltransferase 89.1
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Pr 87.24
PRK05205 176 bifunctional pyrimidine regulatory protein PyrR ur 86.61
TIGR01203166 HGPRTase hypoxanthine phosphoribosyltransferase. S 84.66
PRK07349 500 amidophosphoribosyltransferase; Provisional 84.38
PRK09123 479 amidophosphoribosyltransferase; Provisional 84.31
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisiona 83.84
PRK02269 320 ribose-phosphate pyrophosphokinase; Provisional 82.14
COG2236 192 Predicted phosphoribosyltransferases [General func 81.94
>KOG1712 consensus Adenine phosphoribosyl transferases [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=99.95  E-value=8.8e-29  Score=183.46  Aligned_cols=81  Identities=36%  Similarity=0.611  Sum_probs=75.8

Q ss_pred             cccccc----cccCCeeEE-EccccccccchhHHHHhhhcCC--C---CCCcEEEeeccccccchHHHHHHhCCCEEeee
Q 047783            8 QKSHHS----ATVQTIILN-WTPISHRFSVSLSFRHKLFSEP--S---PSVRFLQGIKARGFIFGPPIAWAIGAKFVPMR   77 (90)
Q Consensus         8 ~~~~~~----~p~pGI~F~-itP~l~rd~v~~~~~~~~l~~~--~---~~~d~IagiEaRGFi~ga~lA~~lg~gfv~vR   77 (90)
                      .|++||    ||++||+|+ |+|++. |..+|+..+|.|+++  .   .++|+|||+|||||+||+++|.++|++||++|
T Consensus        11 ik~~ir~~pdFPk~GI~F~Di~pll~-dP~af~~lidlf~~h~~~~~~~~Id~iaGlEaRGFLFGP~iAlalG~~fVPiR   89 (183)
T KOG1712|consen   11 IKTAIRVVPDFPKKGIMFQDITPLLL-DPKAFKKLIDLFVDHYRETFEMKIDVIAGLEARGFLFGPSIALALGAGFVPIR   89 (183)
T ss_pred             HHHhheeCCCCCCCceehhhhhhhhc-CHHHHHHHHHHHHHHHHHHhcCcceEEEeeeecceecCcHHHHHhCCCeeecc
Confidence            477777    999999999 999985 999999999999988  3   67999999999999999999999999999999


Q ss_pred             CCCCCCcccccc
Q 047783           78 KPKKLPGKSLHL   89 (90)
Q Consensus        78 K~GKLPg~~~s~   89 (90)
                      |+|||||+++++
T Consensus        90 K~gKLPG~~i~~  101 (183)
T KOG1712|consen   90 KPGKLPGEVISE  101 (183)
T ss_pred             cCCCCCCceeEE
Confidence            999999999875

>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02293 adenine phosphoribosyltransferase Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase Back     alignment and domain information
>PRK09219 xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>TIGR01744 XPRTase xanthine phosphoribosyltransferase Back     alignment and domain information
>PRK09213 pur operon repressor; Provisional Back     alignment and domain information
>TIGR01743 purR_Bsub pur operon repressor, Bacillus subtilis type Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13810 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK12560 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13809 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>PF00156 Pribosyltran: Phosphoribosyl transferase domain; InterPro: IPR000836 The name PRT comes from phosphoribosyltransferase (PRTase) enzymes, which carry out phosphoryl transfer reactions on 5-phosphoribosyl-alpha1-pyrophosphate PRPP, an activated form of ribose-5-phosphate Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PLN02238 hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
1g2q_A187 Crystal Structure Of Adenine Phosphoribosyltransfer 9e-08
2dy0_A190 Crystal Structure Of Project Jw0458 From Escherichi 1e-06
1ore_A180 Human Adenine Phosphoribosyltransferase Length = 18 1e-05
1l1q_A186 Crystal Structure Of Aprtase From Giardia Lamblia C 2e-04
1mzv_A 235 Crystal Structure Of Adenine Phosphoribosyltransfer 4e-04
>pdb|1G2Q|A Chain A, Crystal Structure Of Adenine Phosphoribosyltransferase Length = 187 Back     alignment and structure 
Iteration: 1

 Score = 52.0 bits (123), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 31/43 (72%)
Query: 44 PSPSVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGKS 86
          P   + ++ G+++RGF+FGP +A A+G  FVP+RK  KLPG+ 
Sbjct: 56 PEVKIDYIVGLESRGFLFGPTLALALGVGFVPVRKAGKLPGEC 98
>pdb|2DY0|A Chain A, Crystal Structure Of Project Jw0458 From Escherichia Coli Length = 190 Back     alignment and structure
>pdb|1ORE|A Chain A, Human Adenine Phosphoribosyltransferase Length = 180 Back     alignment and structure
>pdb|1L1Q|A Chain A, Crystal Structure Of Aprtase From Giardia Lamblia Complexed With 9- Deazaadenine Length = 186 Back     alignment and structure
>pdb|1MZV|A Chain A, Crystal Structure Of Adenine Phosphoribosyltransferase (Aprt) From Leishmania Tarentolae Length = 235 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 3e-16
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 3e-16
1qb7_A 236 APRT, adenine phosphoribosyltransferase; dinucleot 1e-15
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 2e-15
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 8e-15
1o57_A 291 PUR operon repressor; purine operon repressor, hel 4e-09
1y0b_A 197 Xanthine phosphoribosyltransferase; purine metabol 1e-08
1vch_A175 Phosphoribosyltransferase-related protein; structu 6e-05
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Length = 180 Back     alignment and structure
 Score = 68.3 bits (168), Expect = 3e-16
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 53 GIKARGFIFGPPIAWAIGAKFVPMRKPKKLPGK 85
          G+ +RGF+FGP +A  +G   V +RK  KLPG 
Sbjct: 63 GLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGP 95
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Length = 187 Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Length = 236 Back     alignment and structure
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Length = 190 Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Length = 186 Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Length = 291 Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Length = 197 Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Length = 175 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
1qb7_A 236 APRT, adenine phosphoribosyltransferase; dinucleot 99.4
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 99.36
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 99.36
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 99.27
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 99.19
1vch_A175 Phosphoribosyltransferase-related protein; structu 98.77
3ozf_A 250 Hypoxanthine-guanine-xanthine phosphoribosyltrans; 98.74
3n2l_A 238 OPRT, oprtase, orotate phosphoribosyltransferase; 98.59
1fsg_A 233 HGPRTASE, hypoxanthine-guanine phosphoribosyltrans 98.56
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; 98.52
3m3h_A 234 OPRT, oprtase, orotate phosphoribosyltransferase; 98.47
3qw4_B453 UMP synthase; N-terminal orotidine monophosphate d 98.47
3hvu_A 204 Hypoxanthine phosphoribosyltransferase; hypoxanthi 98.45
1z7g_A 217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos 98.42
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; 98.42
3mjd_A 232 Orotate phosphoribosyltransferase; IDP02311, csgid 98.37
1o57_A 291 PUR operon repressor; purine operon repressor, hel 98.33
1lh0_A 213 OMP synthase; loop closure, monomer closure, orota 98.28
1y0b_A 197 Xanthine phosphoribosyltransferase; purine metabol 98.21
2ps1_A 226 Orotate phosphoribosyltransferase 1; alpha beta, o 98.11
2wns_A205 Orotate phosphoribosyltransferase; alternative spl 97.96
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; 97.94
2jbh_A 225 Phosphoribosyltransferase domain-containing prote; 97.9
2p1z_A180 Phosphoribosyltransferase; STRU genomics, PSI-2, p 97.54
3lrt_A286 Ribose-phosphate pyrophosphokinase; phosphoribosyl 97.35
3o7m_A 186 Hypoxanthine phosphoribosyltransferase; hypoxanthi 97.24
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; 96.98
1pzm_A 211 HGPRT, hypoxanthine-guanine phosphoribosyltransfer 96.87
1hgx_A 183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphori 96.82
2geb_A 185 Hypoxanthine-guanine phosphoribosyltransferase; HG 96.77
3dah_A 319 Ribose-phosphate pyrophosphokinase; pyrophosphoki 96.46
1vdm_A153 Purine phosphoribosyltransferase; structural genom 96.42
1yfz_A 205 Hypoxanthine-guanine phosphoribosyltransferase; pr 96.3
3s5j_B 326 Ribose-phosphate pyrophosphokinase 1; nucleotide s 96.28
2xbu_A 221 Hypoxanthine-guanine phosphoribosyltransferase; gl 96.14
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy 95.82
2ji4_A 379 Phosphoribosyl pyrophosphate synthetase-associated 95.75
2ywu_A 181 Hypoxanthine-guanine phosphoribosyltransferase; ro 95.73
1tc1_A 220 Protein (hypoxanthine phosphoribosyltransferase); 95.47
3ohp_A 177 Hypoxanthine phosphoribosyltransferase; structural 94.87
1wd5_A 208 Hypothetical protein TT1426; structural genomics, 94.63
1a3c_A 181 PYRR, pyrimidine operon regulatory protein PYRR; t 94.15
1w30_A 201 PYRR bifunctional protein; transferase, glycosyltr 93.13
1dku_A 317 Protein (phosphoribosyl pyrophosphate synthetase); 92.79
1ufr_A 181 TT1027, PYR mRNA-binding attenuation protein; pyri 90.09
1ecf_A 504 Glutamine phosphoribosylpyrophosphate amidotransf; 83.71
1dqn_A 230 Guanine phosphoribosyltransferase; protein-inhibit 81.06
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Back     alignment and structure
Probab=99.40  E-value=7.5e-14  Score=102.88  Aligned_cols=81  Identities=27%  Similarity=0.385  Sum_probs=69.9

Q ss_pred             eccccccc-----cccCCe-eEE-EccccccccchhHHHHhhhcCC----CCCCcEEEeeccccccchHHHHHHhCCCEE
Q 047783            6 IDQKSHHS-----ATVQTI-ILN-WTPISHRFSVSLSFRHKLFSEP----SPSVRFLQGIKARGFIFGPPIAWAIGAKFV   74 (90)
Q Consensus         6 ~~~~~~~~-----~p~pGI-~F~-itP~l~rd~v~~~~~~~~l~~~----~~~~d~IagiEaRGFi~ga~lA~~lg~gfv   74 (90)
                      .++|++++     ||++|| .|. +++.+. +...+..+.+.|++.    +.++|+|+|++.|||.+|..+|.++|+|++
T Consensus        20 ~~l~~~i~~~~~dfp~~gip~~~D~~~ll~-~~~~~~~~~~~la~~i~~~~~~~d~Ivgv~~gG~~~a~~lA~~L~~p~~   98 (236)
T 1qb7_A           20 QLLKKSYRWYSPVFSPRNVPRFADVSSITE-SPETLKAIRDFLVQRYRAMSPAPTHILGFDARGFLFGPMIAVELEIPFV   98 (236)
T ss_dssp             HHHHHHCCEECGGGSSSCSSSEECTHHHHT-CHHHHHHHHHHHHHHHHHCSSCCSEEEEETTGGGGTHHHHHHHHTCCEE
T ss_pred             HHHHHHhcccCCCCCCCCCEeEEEhHhhcC-CHHHHHHHHHHHHHHHHhhCCCCCEEEEECcCcHHHHHHHHHHhCCCEE
Confidence            34666665     899999 999 898875 888888888888765    237999999999999999999999999999


Q ss_pred             eeeCCCCCCcccc
Q 047783           75 PMRKPKKLPGKSL   87 (90)
Q Consensus        75 ~vRK~GKLPg~~~   87 (90)
                      .+||.+|+|+++.
T Consensus        99 ~~rk~~k~~~~~~  111 (236)
T 1qb7_A           99 LMRKADKNAGLLI  111 (236)
T ss_dssp             EEBCGGGCCSSEE
T ss_pred             EEEEecCCCCcce
Confidence            9999999998765
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Back     alignment and structure
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} Back     alignment and structure
>3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} SCOP: c.61.1.0 Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* Back     alignment and structure
>3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A Back     alignment and structure
>2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding P pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* Back     alignment and structure
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Back     alignment and structure
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Back     alignment and structure
>1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Back     alignment and structure
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
d1l1qa_181 Adenine PRTase {Giardia lamblia [TaxId: 5741]} 99.83
d1g2qa_178 Adenine PRTase {Baker's yeast (Saccharomyces cerev 99.82
d1zn7a1178 Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] 99.81
d1qb7a_ 236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 99.76
d1o57a2 202 Pur operon repressor (PurR), C-terminal domain {Ba 99.25
d1y0ba1191 Xanthine phosphoribosyltransferase {Bacillus subti 99.17
d1vcha1174 Putative phosphoribosyltransferase TTHA1613 {Therm 99.14
d2aeea1208 Orotate PRTase {Streptococcus pyogenes [TaxId: 131 98.29
d1vdma1153 Pprobable purine phosphoribosyltransferase PH0095 96.96
d1lh0a_ 213 Orotate PRTase {Salmonella typhimurium [TaxId: 903 95.49
d1nula_150 Xanthine-guanine PRTase (XPRTase) {Escherichia col 94.99
d1wd5a_ 208 Putative phosphoribosyltransferase TT1426 (TTHA146 89.04
d1u9ya2129 Phosphoribosylpyrophosphate synthetase {Methanocal 86.92
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Adenine PRTase
species: Giardia lamblia [TaxId: 5741]

Probab=99.83  E-value=5.6e-22  Score=141.37  Aligned_cols=81  Identities=27%  Similarity=0.412  Sum_probs=76.2

Q ss_pred             ccccccc----cccCCeeEE-EccccccccchhHHHHhhhcCC--CCCCcEEEeeccccccchHHHHHHhCCCEEeeeCC
Q 047783            7 DQKSHHS----ATVQTIILN-WTPISHRFSVSLSFRHKLFSEP--SPSVRFLQGIKARGFIFGPPIAWAIGAKFVPMRKP   79 (90)
Q Consensus         7 ~~~~~~~----~p~pGI~F~-itP~l~rd~v~~~~~~~~l~~~--~~~~d~IagiEaRGFi~ga~lA~~lg~gfv~vRK~   79 (90)
                      |+|++||    ||+|||.|+ ++|++. |+..+..++++|+++  +.++|+|+|+|+|||.+|+++|++||+|++.+||+
T Consensus         6 ~~~~~i~~~~dfp~~Gi~F~Di~~il~-dp~~~~~~~~~la~~~~~~~~d~Ivgie~~Gi~lA~~lA~~Lg~p~v~~rk~   84 (181)
T d1l1qa_           6 DAHALIKTIPDFPTKGIAFKDLSDILS-TPAALDAVRKEVTAHYKDVPITKVVGIESRGFILGGIVANSLGVGFVALRKA   84 (181)
T ss_dssp             HHHHTCEEETTCSSTTCCEEECHHHHT-CHHHHHHHHHHHHHHTTTSCCCEEEEESGGGHHHHHHHHHHHTCEEEEEEET
T ss_pred             HHHHhcCCCCCCCCCCccEEechhhhC-CHHHHHHHHHHHHHHHhccCCCEEEeeccchhhhHHHHHHHhCCCceeEeec
Confidence            7899999    999999999 999986 999999999999988  55899999999999999999999999999999999


Q ss_pred             CCCCccccc
Q 047783           80 KKLPGKSLH   88 (90)
Q Consensus        80 GKLPg~~~s   88 (90)
                      +|+|+++++
T Consensus        85 ~~~~~~~~~   93 (181)
T d1l1qa_          85 GKLPGDVCK   93 (181)
T ss_dssp             TSSCSSEEE
T ss_pred             ccccccccc
Confidence            999998864
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure